Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DLST/OGDC-E2 Protein, C-Strep

Host species:
Insect cells
Origin species:
Human
Uniprot ID:
P36957
Molecular weight:
42.70 kDa

Original price was: $392.00.Current price is: $350.00.

50ug 11% OFF + 350 loyalty points
Asp68–Leu453 Strep
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DLST/OGDC-E2 Protein, C-Strep

Product name ARO-P15979-100
Uniprot ID P36957
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Molecular weight 42.70 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Asp68-Leu453
Aliases /Synonyms Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial, 2.3.1.61, 2-oxoglutarate dehydrogenase complex component E2, OGDC-E2, Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, E2K, DLST, DLTS
Reference ARO-P15979
Note For research use only.
Molecular Constructor
Asp68–Leu453 Strep
Product name ARO-P15979-1MG
Uniprot ID P36957
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Molecular weight 42.70 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Asp68-Leu453
Aliases /Synonyms Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial, 2.3.1.61, 2-oxoglutarate dehydrogenase complex component E2, OGDC-E2, Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, E2K, DLST, DLTS
Reference ARO-P15979
Note For research use only.
Molecular Constructor
Asp68–Leu453 Strep
Product name ARO-P15979-50
Uniprot ID P36957
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Molecular weight 42.70 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Asp68-Leu453
Aliases /Synonyms Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial, 2.3.1.61, 2-oxoglutarate dehydrogenase complex component E2, OGDC-E2, Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, E2K, DLST, DLTS
Reference ARO-P15979
Note For research use only.
Molecular Constructor
Asp68–Leu453 Strep

There are no reviews yet.

Be the first to review “Recombinant Human DLST/OGDC-E2 Protein, C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products