Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GDI2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P50395
Molecular weight:
52.83 kDa

Original price was: $356.00.Current price is: $274.00.

50ug 23% OFF + 274 loyalty points
Met1–Asp445
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GDI2 Protein, N-His

Product name ARO-P12395-100
Uniprot ID P50395
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Molecular weight 52.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp445
Aliases /Synonyms Guanosine diphosphate dissociation inhibitor 2, GDI-2, Rab GDP dissociation inhibitor beta, Rab GDI beta, RABGDIB, GDI2
Reference ARO-P12395
Note For research use only.
Molecular Constructor
Met1–Asp445
Product name ARO-P12395-1MG
Uniprot ID P50395
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Molecular weight 52.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp445
Aliases /Synonyms Guanosine diphosphate dissociation inhibitor 2, GDI-2, Rab GDP dissociation inhibitor beta, Rab GDI beta, RABGDIB, GDI2
Reference ARO-P12395
Note For research use only.
Molecular Constructor
Met1–Asp445
Product name ARO-P12395-50
Uniprot ID P50395
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Molecular weight 52.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp445
Aliases /Synonyms Guanosine diphosphate dissociation inhibitor 2, GDI-2, Rab GDP dissociation inhibitor beta, Rab GDI beta, RABGDIB, GDI2
Reference ARO-P12395
Note For research use only.
Molecular Constructor
Met1–Asp445

Introduction to Recombinant Human GDI2 Protein

Recombinant Human GDI2 Protein, also known as GDP dissociation inhibitor 2, is a protein that plays a crucial role in regulating the activity of small GTPases. This protein is encoded by the GDI2 gene and is involved in various cellular processes such as cell migration, cytoskeletal organization, and intracellular signaling. In this article, we will discuss the structure, activity, and applications of Recombinant Human GDI2 Protein.

Structure of Recombinant Human GDI2 Protein

Recombinant Human GDI2 Protein is composed of 443 amino acids and has a molecular weight of approximately 48 kDa. It consists of three distinct domains: an N-terminal regulatory domain, a central catalytic domain, and a C-terminal lipid-binding domain. The N-terminal domain is responsible for the binding of small GTPases, while the catalytic domain is involved in the dissociation of GDP from the GTPases. The lipid-binding domain is responsible for the interaction of GDI2 with cellular membranes.

Activity of Recombinant Human GDI2 Protein

The main function of Recombinant Human GDI2 Protein is to regulate the activity of small GTPases, which are essential for various cellular processes. These GTPases act as molecular switches, cycling between an active GTP-bound state and an inactive GDP-bound state. GDI2 binds to the GDP-bound form of small GTPases and prevents them from being activated, thereby regulating their activity. This protein also plays a role in the transport of GTPases between cellular compartments.

Apart from its role in regulating GTPases, Recombinant Human GDI2 Protein has been shown to have other activities as well. It has been reported to interact with actin and microtubules, suggesting a potential role in regulating the cytoskeleton. It has also been shown to interact with various signaling proteins, indicating its involvement in intracellular signaling pathways.

Applications of Recombinant Human GDI2 Protein

Recombinant Human GDI2 Protein has been widely used in various research studies to understand its role in cellular processes. It has also been explored as a potential therapeutic target for various diseases. For instance, GDI2 has been found to be upregulated in certain types of cancer, and targeting this protein may have therapeutic benefits. Additionally, GDI2 has been shown to play a role in neuronal development and function, making it a potential target for neurological disorders.

Moreover, Recombinant Human GDI2 Protein has been used in the development of diagnostic assays and vaccines. It has been reported to act as an antigen in the immune response against certain types of cancer, making it a potential biomarker for cancer diagnosis and a target for cancer vaccines.

In summary, Recombinant Human GDI2 Protein is a crucial regulator of small GTPases and plays a role in various cellular processes. Its structure, activity, and potential applications make it a valuable protein for research and therapeutic purposes. Further studies on this protein may provide a better understanding of its functions and potential as a therapeutic target.

Recombinant Human GDI2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GDI2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products