Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CRIP1 Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P50238
Molecular weight:
35.24 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
GST Pro2–Lys77
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CRIP1 Protein, N-GST

Product name ARO-P14987-100
Uniprot ID P50238
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Molecular weight 35.24 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Lys77
Aliases /Synonyms CRIP, CRP-1, Cysteine-rich intestinal protein, CRP1, Cysteine-rich heart protein, CRHP, CRIP1, hCRHP, Cysteine-rich protein 1
Reference ARO-P14987
Note For research use only.
Molecular Constructor
GST Pro2–Lys77
Product name ARO-P14987-1MG
Uniprot ID P50238
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Molecular weight 35.24 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Lys77
Aliases /Synonyms CRIP, CRP-1, Cysteine-rich intestinal protein, CRP1, Cysteine-rich heart protein, CRHP, CRIP1, hCRHP, Cysteine-rich protein 1
Reference ARO-P14987
Note For research use only.
Molecular Constructor
GST Pro2–Lys77
Product name ARO-P14987-50
Uniprot ID P50238
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Molecular weight 35.24 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Lys77
Aliases /Synonyms CRIP, CRP-1, Cysteine-rich intestinal protein, CRP1, Cysteine-rich heart protein, CRHP, CRIP1, hCRHP, Cysteine-rich protein 1
Reference ARO-P14987
Note For research use only.
Molecular Constructor
GST Pro2–Lys77

There are no reviews yet.

Be the first to review “Recombinant Human CRIP1 Protein, N-GST”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products