Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPAT3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q53EU6
Molecular weight:
28.01 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Ser207–Ser434
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPAT3 Protein, N-His

Product name ARO-P12084-100
Uniprot ID Q53EU6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser207-Ser434
Aliases /Synonyms 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9, AGPAT 10, 1-AGPAT 9, GPAT-3, hGPAT3, Glycerol-3-phosphate acyltransferase 3, Lysophosphatidic acid acyltransferase theta, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, LPAAT-theta, Acyl-CoA:glycerol-3-phosphate acyltransferase 3, 1-AGP acyltransferase 9, Lung cancer metastasis-associated protein 1, MAG1, MAG-1, GPAT3, AGPAT9
Reference ARO-P12084
Note For research use only.
Molecular Constructor
Ser207–Ser434
Product name ARO-P12084-1MG
Uniprot ID Q53EU6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser207-Ser434
Aliases /Synonyms 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9, AGPAT 10, 1-AGPAT 9, GPAT-3, hGPAT3, Glycerol-3-phosphate acyltransferase 3, Lysophosphatidic acid acyltransferase theta, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, LPAAT-theta, Acyl-CoA:glycerol-3-phosphate acyltransferase 3, 1-AGP acyltransferase 9, Lung cancer metastasis-associated protein 1, MAG1, MAG-1, GPAT3, AGPAT9
Reference ARO-P12084
Note For research use only.
Molecular Constructor
Ser207–Ser434
Product name ARO-P12084-50
Uniprot ID Q53EU6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS
Molecular weight 28.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser207-Ser434
Aliases /Synonyms 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9, AGPAT 10, 1-AGPAT 9, GPAT-3, hGPAT3, Glycerol-3-phosphate acyltransferase 3, Lysophosphatidic acid acyltransferase theta, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, LPAAT-theta, Acyl-CoA:glycerol-3-phosphate acyltransferase 3, 1-AGP acyltransferase 9, Lung cancer metastasis-associated protein 1, MAG1, MAG-1, GPAT3, AGPAT9
Reference ARO-P12084
Note For research use only.
Molecular Constructor
Ser207–Ser434

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the DNA sequence encoding for a specific protein is inserted into a host organism, such as bacteria, to produce the desired protein. One such recombinant protein is the Recombinant Human GPAT3 Protein, which has gained significant attention in the scientific community due to its potential therapeutic applications. In this article, we will delve into the structure, activity, and application of this protein in detail.

Structure of Recombinant Human GPAT3 Protein

The Recombinant Human GPAT3 Protein is a 35-kDa protein that belongs to the glycerol-3-phosphate acyltransferase (GPAT) family. It is composed of 319 amino acids and has a conserved catalytic domain, which is essential for its enzymatic activity. The protein also contains a transmembrane domain, which is responsible for its localization in the endoplasmic reticulum (ER) membrane.

The crystal structure of Recombinant Human GPAT3 Protein has been determined, revealing a homodimeric structure with each monomer containing an active site for catalyzing the transfer of fatty acids to glycerol-3-phosphate. The dimeric structure of the protein is crucial for its activity, as it allows for efficient binding and transfer of fatty acids.

Activity of Recombinant Human GPAT3 Protein

The main function of Recombinant Human GPAT3 Protein is to catalyze the first step in the biosynthesis of glycerolipids, which are essential components of cell membranes. This involves the transfer of an acyl group from acyl-CoA to glycerol-3-phosphate, resulting in the formation of lysophosphatidic acid (LPA). LPA is then further modified to form different types of glycerolipids, such as phosphatidic acid and triacylglycerols, which play critical roles in various cellular processes.

Recent studies have also shown that Recombinant Human GPAT3 Protein has a role in regulating insulin sensitivity and glucose metabolism. It has been found that the protein is upregulated in insulin-resistant tissues, and its inhibition leads to improved insulin sensitivity and glucose uptake. This suggests that Recombinant Human GPAT3 Protein may be a potential target for the development of new therapies for insulin resistance and type 2 diabetes.

Application of Recombinant Human GPAT3 Protein

The unique structure and activity of Recombinant Human GPAT3 Protein make it a promising candidate for various therapeutic applications. One of the most significant applications of this protein is in the development of drugs for the treatment of metabolic disorders, such as obesity and diabetes. As mentioned earlier, the protein plays a crucial role in regulating glucose metabolism and insulin sensitivity, making it a potential target for the development of drugs that can improve these conditions.

Additionally, Recombinant Human GPAT3 Protein has also shown potential in the treatment of certain types of cancer. Studies have found that the protein is overexpressed in some cancer cells, and its inhibition leads to reduced cell proliferation and increased cell death. This makes it a potential target for the development of anti-cancer drugs.

Another potential application of Recombinant Human GPAT3 Protein is in the production of biofuels. The protein’s ability to catalyze the biosynthesis of triacylglycerols makes it a promising candidate for the production of biodiesel, which can be used as a sustainable alternative to fossil fuels.

Conclusion

In conclusion, Recombinant Human GPAT3 Protein is a 35-kDa protein with a homodimeric structure and essential role in the biosynthesis of glycerolipids. Its unique structure and activity make

Recombinant Human GPAT3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPAT3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products