Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human OPTN Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96CV9
Molecular weight:
40.77 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Ser415–Arg524
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human OPTN Protein, N-GST & C-His

Product name ARO-P12618-100
Uniprot ID Q96CV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGAR
Molecular weight 40.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser415-Arg524
Aliases /Synonyms NRP, TFIIIA-IntP, Huntingtin-interacting protein 7, HIP-7, Huntingtin yeast partner L, Transcription factor IIIA-interacting protein, NEMO-related protein, E3-14.7K-interacting protein, GLC1E, HIP7, HYPL, FIP-2, Huntingtin-interacting protein L, Optic neuropathy-inducing protein, OPTN, Optineurin, FIP2
Reference ARO-P12618
Note For research use only.
Molecular Constructor
Ser415–Arg524
Product name ARO-P12618-1MG
Uniprot ID Q96CV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGAR
Molecular weight 40.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser415-Arg524
Aliases /Synonyms NRP, TFIIIA-IntP, Huntingtin-interacting protein 7, HIP-7, Huntingtin yeast partner L, Transcription factor IIIA-interacting protein, NEMO-related protein, E3-14.7K-interacting protein, GLC1E, HIP7, HYPL, FIP-2, Huntingtin-interacting protein L, Optic neuropathy-inducing protein, OPTN, Optineurin, FIP2
Reference ARO-P12618
Note For research use only.
Molecular Constructor
Ser415–Arg524
Product name ARO-P12618-50
Uniprot ID Q96CV9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGAR
Molecular weight 40.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser415-Arg524
Aliases /Synonyms NRP, TFIIIA-IntP, Huntingtin-interacting protein 7, HIP-7, Huntingtin yeast partner L, Transcription factor IIIA-interacting protein, NEMO-related protein, E3-14.7K-interacting protein, GLC1E, HIP7, HYPL, FIP-2, Huntingtin-interacting protein L, Optic neuropathy-inducing protein, OPTN, Optineurin, FIP2
Reference ARO-P12618
Note For research use only.
Molecular Constructor
Ser415–Arg524

Recombinant Human OPTN Protein: Structure, Activity, and Applications

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various scientific and medical applications. One such protein is the Optineurin (OPTN) protein, which has gained significant attention due to its diverse functions and potential therapeutic applications. In this article, we will explore the structure, activity, and applications of recombinant human OPTN protein.

Structure of Recombinant Human OPTN Protein

The OPTN gene is located on chromosome 10 and encodes a 577 amino acid protein. The recombinant human OPTN protein is produced by cloning and expressing the OPTN gene in a suitable host cell, such as Escherichia coli or Chinese hamster ovary (CHO) cells. The resulting protein is a homodimer with a molecular weight of approximately 67 kDa.

The primary structure of OPTN protein consists of multiple functional domains, including a ubiquitin-binding domain, an N-terminal coiled-coil domain, and a C-terminal zinc finger domain. These domains play a crucial role in the protein’s activity and interactions with other cellular components.

Activity of Recombinant Human OPTN Protein

OPTN protein is involved in various cellular processes, including autophagy, vesicle trafficking, and immune response. It acts as a receptor for ubiquitin and regulates the degradation of damaged or misfolded proteins through the autophagy pathway. It also plays a role in the transport of vesicles within the cell and is essential for maintaining cellular homeostasis.

Moreover, OPTN protein has been shown to interact with several proteins involved in the immune response, such as tumor necrosis factor receptor-associated factor 6 (TRAF6) and nuclear factor kappa B (NF-κB). These interactions suggest a potential role of OPTN in regulating the inflammatory response and immune cell function.

Applications of Recombinant Human OPTN Protein

Due to its diverse functions, recombinant human OPTN protein has several potential applications in the fields of research and medicine.

One of the primary applications of OPTN protein is in studying autophagy and its role in various diseases. Recombinant OPTN protein can be used to study the mechanisms of autophagy and its dysregulation in diseases such as neurodegenerative disorders and cancer.

In addition, OPTN protein has been implicated in various immune-related disorders, making it a potential therapeutic target. Recombinant OPTN protein can be used to develop novel therapies for these diseases by modulating its activity or interactions with other proteins.

Furthermore, recombinant OPTN protein has been used in the development of diagnostic assays for diseases such as glaucoma and amyotrophic lateral sclerosis (ALS). Its interaction with TRAF6 has been linked to glaucoma, and measuring the levels of OPTN protein in the eye can aid in early detection and management of the disease. Similarly, the presence of OPTN protein in the cerebrospinal fluid can serve as a biomarker for ALS.

Conclusion

In conclusion, recombinant human OPTN protein is a versatile protein with multiple functions and potential applications. Its structure, activity, and interactions make it an essential tool in studying autophagy, immune response, and various diseases. With ongoing research, the potential applications of OPTN protein in medicine and biotechnology are likely to expand, making it an exciting area of study for scientists and clinicians alike.

Recombinant Human OPTN Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human OPTN Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products