Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human H2AJ, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BTM1
Molecular weight:
16.11 kDa

Original price was: $345.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Gly3–Lys129
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human H2AJ, N-His

Product name ARO-P13133-100
Uniprot ID Q9BTM1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Molecular weight 16.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly3-Lys129
Aliases /Synonyms Histone H2A.J, H2AFJ, H2a/j, H2AJ
Reference ARO-P13133
Note For research use only.
Molecular Constructor
Gly3–Lys129
Product name ARO-P13133-1MG
Uniprot ID Q9BTM1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Molecular weight 16.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly3-Lys129
Aliases /Synonyms Histone H2A.J, H2AFJ, H2a/j, H2AJ
Reference ARO-P13133
Note For research use only.
Molecular Constructor
Gly3–Lys129
Product name ARO-P13133-50
Uniprot ID Q9BTM1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKTKSK
Molecular weight 16.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly3-Lys129
Aliases /Synonyms Histone H2A.J, H2AFJ, H2a/j, H2AJ
Reference ARO-P13133
Note For research use only.
Molecular Constructor
Gly3–Lys129

Introduction

Recombinant Human H2AJ is a protein that has gained significant interest in the field of molecular biology and biochemistry. It is a recombinant form of the human histone H2A variant, H2AJ, which is involved in chromatin remodeling and gene expression regulation. In this article, we will discuss the structure, activity, and application of Recombinant Human H2AJ.

Structure of Recombinant Human H2AJ

Recombinant Human H2AJ is a 14 kDa protein that consists of 128 amino acids. It shares a high sequence homology with the canonical histone H2A, with only a few amino acid substitutions. The protein contains a highly conserved histone fold domain, which is responsible for its interaction with DNA. It also has a short N-terminal tail, which is involved in protein-protein interactions and post-translational modifications.

Activity of Recombinant Human H2AJ

Recombinant Human H2AJ has been shown to play a crucial role in chromatin remodeling and gene expression regulation. It is involved in the formation of nucleosomes, which are the basic units of chromatin. The protein binds to DNA and forms a stable complex with other histone proteins, resulting in the compaction of DNA and the regulation of gene expression. Additionally, Recombinant Human H2AJ has been found to play a role in DNA damage response and repair processes.

Application of Recombinant Human H2AJ

The unique properties of Recombinant Human H2AJ make it a valuable tool in various research applications. One of its main applications is in studying chromatin remodeling and gene expression regulation. The recombinant protein can be used to investigate the role of H2AJ in these processes and its interaction with other histone proteins and transcription factors.

Recombinant Human H2AJ can also be used in drug discovery and development. As it is involved in DNA damage response and repair, it can be a potential target for the treatment of diseases such as cancer. Researchers can use the recombinant protein to screen for compounds that can modulate its activity and potentially develop new therapies.

Moreover, Recombinant Human H2AJ can be used in diagnostic assays as an antigen. Its specific binding to DNA and its involvement in gene expression regulation make it a suitable candidate for detecting chromatin-related diseases and disorders.

Conclusion

In summary, Recombinant Human H2AJ is a recombinant form of the human histone H2A variant, which plays a crucial role in chromatin remodeling and gene expression regulation. Its structure, activity, and application make it a valuable tool in various research areas, including chromatin biology, drug discovery, and diagnostics. Further studies on this protein are needed to fully understand its functions and potential therapeutic applications.

Recombinant Human H2AJ, N-His

There are no reviews yet.

Be the first to review “Recombinant Human H2AJ, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products