Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human H3C15, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q71DI3
Molecular weight:
17.70 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Met1–Ala136
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human H3C15, N-His

Product name ARO-P13282-100
Uniprot ID Q71DI3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 17.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala136
Aliases /Synonyms HIST2H3A, H3C15, Histone H3/o, H3-clustered histone 14, H3-clustered histone 15, H3-clustered histone 13, H3F2, H3FM, Histone H3/m, HIST2H3D, HIST2H3C, Histone H3.2
Reference ARO-P13282
Note For research use only.
Molecular Constructor
Met1–Ala136
Product name ARO-P13282-1MG
Uniprot ID Q71DI3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 17.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala136
Aliases /Synonyms HIST2H3A, H3C15, Histone H3/o, H3-clustered histone 14, H3-clustered histone 15, H3-clustered histone 13, H3F2, H3FM, Histone H3/m, HIST2H3D, HIST2H3C, Histone H3.2
Reference ARO-P13282
Note For research use only.
Molecular Constructor
Met1–Ala136
Product name ARO-P13282-50
Uniprot ID Q71DI3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 17.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala136
Aliases /Synonyms HIST2H3A, H3C15, Histone H3/o, H3-clustered histone 14, H3-clustered histone 15, H3-clustered histone 13, H3F2, H3FM, Histone H3/m, HIST2H3D, HIST2H3C, Histone H3.2
Reference ARO-P13282
Note For research use only.
Molecular Constructor
Met1–Ala136

SDS-PAGE for Recombinant Human H3C15, N-His

SDS-PAGE for Recombinant Human H3C15, N-His

Recombinant Human H3C15, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SDS-PAGE for Recombinant Human H3C15, N-His

SDS-PAGE for Recombinant Human H3C15, N-His

Recombinant Human H3C15, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human H3C15, N-His

There are no reviews yet.

Be the first to review “Recombinant Human H3C15, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products