Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ING2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H160
Molecular weight:
35.17 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Glu204–Glu263
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ING2 Protein, N-GST & C-His

Product name ARO-P12373-100
Uniprot ID Q9H160
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE
Molecular weight 35.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu204-Glu263
Aliases /Synonyms ING2, p32, ING1Lp, p33ING2, Inhibitor of growth protein 2, ING1L, Inhibitor of growth 1-like protein
Reference ARO-P12373
Note For research use only.
Molecular Constructor
Glu204–Glu263
Product name ARO-P12373-1MG
Uniprot ID Q9H160
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE
Molecular weight 35.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu204-Glu263
Aliases /Synonyms ING2, p32, ING1Lp, p33ING2, Inhibitor of growth protein 2, ING1L, Inhibitor of growth 1-like protein
Reference ARO-P12373
Note For research use only.
Molecular Constructor
Glu204–Glu263
Product name ARO-P12373-50
Uniprot ID Q9H160
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNE
Molecular weight 35.17 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu204-Glu263
Aliases /Synonyms ING2, p32, ING1Lp, p33ING2, Inhibitor of growth protein 2, ING1L, Inhibitor of growth 1-like protein
Reference ARO-P12373
Note For research use only.
Molecular Constructor
Glu204–Glu263

Introduction to Recombinant Human ING2 Protein

Recombinant Human ING2 Protein is a synthetic protein that is produced in the laboratory using genetic engineering techniques. It is derived from the human ING2 gene, which codes for the ING2 protein. This protein plays a crucial role in regulating gene expression and is involved in various cellular processes such as DNA repair, cell cycle control, and apoptosis.

Structure of Recombinant Human ING2 Protein

The recombinant form of ING2 protein is a 33 kDa protein consisting of 281 amino acids. It has a conserved N-terminal PHD (plant homeodomain) finger domain, which is responsible for binding to histone H3 and H4, and a C-terminal domain that interacts with other proteins involved in gene regulation.

The crystal structure of the recombinant ING2 protein has been determined, revealing a compact globular structure with a central beta-sheet surrounded by alpha-helices. This structure is crucial for the protein’s function as it allows it to interact with other proteins and DNA.

Activity of Recombinant Human ING2 Protein

Recombinant Human ING2 Protein has been shown to have a variety of activities in regulating gene expression. It acts as a tumor suppressor by inhibiting cell growth and promoting cell death in cancer cells. It also plays a role in DNA repair by interacting with other proteins involved in this process.

One of the key activities of ING2 protein is its ability to bind to histones and regulate their acetylation. Histones are proteins that package DNA in the nucleus, and their acetylation status is crucial for gene expression. ING2 protein acts as a scaffold for other proteins involved in histone acetylation, thereby regulating gene expression.

Moreover, ING2 protein also interacts with other proteins involved in the cell cycle, such as p53, to regulate cell growth and division. It has been shown to induce cell cycle arrest and promote cell death in cancer cells, making it a potential target for cancer therapy.

Application of Recombinant Human ING2 Protein

Recombinant Human ING2 Protein has various applications in the field of biotechnology and medicine. One of the most significant applications is its potential as a therapeutic target for cancer treatment. Studies have shown that ING2 protein is downregulated in various cancers, and its overexpression can inhibit tumor growth and induce cell death in cancer cells.

Furthermore, ING2 protein can also be used as a diagnostic marker for cancer. Its expression levels have been correlated with the aggressiveness of certain cancers, making it a potential biomarker for cancer diagnosis and prognosis.

In addition to cancer, ING2 protein has also been linked to other diseases such as Alzheimer’s and cardiovascular diseases. Its role in DNA repair and cell cycle regulation makes it a potential target for the treatment of these diseases.

Conclusion

Recombinant Human ING2 Protein is a crucial protein involved in regulating gene expression and various cellular processes. Its structure and activity have been extensively studied, and it has shown promising potential as a therapeutic target for cancer and other diseases. Further research and development of ING2 protein may lead to the development of new treatments for these diseases and improve human health.

Recombinant Human ING2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human ING2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products