Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human PAK2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13177
Molecular weight:
29.16 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Glu177–Ala419
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Human PAK2, N-His
Recombinant Human PAK2, N-His

Recombinant Human PAK2, N-His

Product name ARO-P13438-100
Uniprot ID Q13177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA
Molecular weight 29.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Ala419
Aliases /Synonyms S6/H4 kinase, p21-activated kinase 2, p58, PAK-2, PAK2, C-t-PAK2, PAK65, p34, Gamma-PAK, Serine/threonine-protein kinase PAK 2, p27
Reference ARO-P13438
Note For research use only.
Molecular Constructor
Glu177–Ala419
Product name ARO-P13438-1MG
Uniprot ID Q13177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA
Molecular weight 29.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Ala419
Aliases /Synonyms S6/H4 kinase, p21-activated kinase 2, p58, PAK-2, PAK2, C-t-PAK2, PAK65, p34, Gamma-PAK, Serine/threonine-protein kinase PAK 2, p27
Reference ARO-P13438
Note For research use only.
Molecular Constructor
Glu177–Ala419
Product name ARO-P13438-50
Uniprot ID Q13177
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKA
Molecular weight 29.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Ala419
Aliases /Synonyms S6/H4 kinase, p21-activated kinase 2, p58, PAK-2, PAK2, C-t-PAK2, PAK65, p34, Gamma-PAK, Serine/threonine-protein kinase PAK 2, p27
Reference ARO-P13438
Note For research use only.
Molecular Constructor
Glu177–Ala419

SDS-PAGE for Recombinant Human PAK2, N-His

SDS-PAGE for Recombinant Human PAK2, N-His

Recombinant Human PAK2, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human PAK2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PAK2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products