Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human H2AZ1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P0C0S5
Molecular weight:
14.16 kDa

Original price was: $320.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Ser19–Val128
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human H2AZ1 Protein, N-His

Product name ARO-P11276-100
Uniprot ID P0C0S5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Molecular weight 14.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Val128
Aliases /Synonyms Histone H2A.Z, H2AZ1, H2AZ, H2A/z, H2AFZ
Reference ARO-P11276
Note For research use only.
Molecular Constructor
Ser19–Val128
Product name ARO-P11276-1MG
Uniprot ID P0C0S5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Molecular weight 14.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Val128
Aliases /Synonyms Histone H2A.Z, H2AZ1, H2AZ, H2A/z, H2AFZ
Reference ARO-P11276
Note For research use only.
Molecular Constructor
Ser19–Val128
Product name ARO-P11276-50
Uniprot ID P0C0S5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Molecular weight 14.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Val128
Aliases /Synonyms Histone H2A.Z, H2AZ1, H2AZ, H2A/z, H2AFZ
Reference ARO-P11276
Note For research use only.
Molecular Constructor
Ser19–Val128

Introduction

Recombinant Human H2AZ1 Protein, also known as Histone H2A.Z, is a highly conserved histone variant that plays a crucial role in regulating gene expression and chromatin structure. This protein is encoded by the H2AZ1 gene and is involved in various cellular processes such as DNA repair, transcriptional regulation, and cell differentiation.

Structure of Recombinant Human H2AZ1 Protein

Recombinant Human H2AZ1 Protein is a 14 kDa protein consisting of 127 amino acids. It is a member of the histone H2A family and shares high sequence similarity with the canonical histone H2A protein. However, it differs in its N-terminal tail, which contains a unique 11 amino acid insertion. This insertion is responsible for the distinct functions of H2AZ1 compared to the canonical H2A.

Activity of Recombinant Human H2AZ1 Protein

Recombinant Human H2AZ1 Protein is involved in the regulation of chromatin structure and gene expression. It functions by replacing the canonical H2A histone in the nucleosome, the basic unit of chromatin. This replacement alters the physical properties of the nucleosome, leading to changes in chromatin structure and accessibility of DNA to transcription factors and other regulatory proteins.

One of the key functions of H2AZ1 is its role in transcriptional regulation. It has been shown to be enriched at the promoters of actively transcribed genes, suggesting that it plays a role in activating gene expression. Additionally, H2AZ1 has also been found to be involved in DNA repair and maintenance of genome stability. It is recruited to sites of DNA damage and aids in the repair process.

Application of Recombinant Human H2AZ1 Protein

Recombinant Human H2AZ1 Protein has a wide range of applications in both basic research and clinical settings. Its role in regulating gene expression makes it a valuable tool for studying various cellular processes. It can be used to investigate the effect of H2AZ1 on transcriptional activity and chromatin structure in different cell types and under various conditions.

In addition, H2AZ1 has been implicated in several diseases, including cancer. Studies have shown that alterations in the expression and function of H2AZ1 can contribute to the development and progression of cancer. Therefore, recombinant H2AZ1 protein can be used to study its role in cancer and potentially develop targeted therapies.

Furthermore, recombinant H2AZ1 protein can also be used in drug discovery and development. As H2AZ1 is involved in various cellular processes, targeting it with specific inhibitors or activators could have therapeutic potential for a range of diseases.

Conclusion

In summary, Recombinant Human H2AZ1 Protein is a highly conserved histone variant with distinct functions in regulating gene expression and chromatin structure. Its structure, activity, and wide range of applications make it a valuable tool for studying various cellular processes and diseases. Further research on this protein could lead to a better understanding of its role in health and disease and potentially pave the way for new therapeutic strategies.

Recombinant Human H2AZ1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human H2AZ1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products