Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HMG20B Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9P0W2
Molecular weight:
23.83 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Tyr77–Gly171
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HMG20B Protein, N-His-SUMO

Product name ARO-P11327-100
Uniprot ID Q9P0W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNG
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr77-Gly171
Aliases /Synonyms HMGX2, BRAF35, HMG domain-containing protein HMGX2, HMG domain-containing protein 2, HMGXB2, Sox-like transcriptional factor, SMARCE1-related protein, HMG box-containing protein 20B, BRCA2-associated factor 35, HMG20B, Structural DNA-binding protein BRAF35, SMARCE1R, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Reference ARO-P11327
Note For research use only.
Molecular Constructor
Tyr77–Gly171
Product name ARO-P11327-1MG
Uniprot ID Q9P0W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNG
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr77-Gly171
Aliases /Synonyms HMGX2, BRAF35, HMG domain-containing protein HMGX2, HMG domain-containing protein 2, HMGXB2, Sox-like transcriptional factor, SMARCE1-related protein, HMG box-containing protein 20B, BRCA2-associated factor 35, HMG20B, Structural DNA-binding protein BRAF35, SMARCE1R, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Reference ARO-P11327
Note For research use only.
Molecular Constructor
Tyr77–Gly171
Product name ARO-P11327-50
Uniprot ID Q9P0W2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence YVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNG
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr77-Gly171
Aliases /Synonyms HMGX2, BRAF35, HMG domain-containing protein HMGX2, HMG domain-containing protein 2, HMGXB2, Sox-like transcriptional factor, SMARCE1-related protein, HMG box-containing protein 20B, BRCA2-associated factor 35, HMG20B, Structural DNA-binding protein BRAF35, SMARCE1R, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related
Reference ARO-P11327
Note For research use only.
Molecular Constructor
Tyr77–Gly171

Introduction to Recombinant Human HMG20B Protein

Recombinant Human HMG20B Protein, also known as high mobility group 20B protein, is a type of recombinant protein that plays an important role in regulating gene expression and chromatin structure. This protein is produced through genetic engineering techniques, making it a valuable tool in various scientific research and applications.

Structure of Recombinant Human HMG20B Protein

The recombinant form of HMG20B protein is a 20 kDa protein that consists of 186 amino acids. It belongs to the high mobility group (HMG) family of proteins, which are characterized by their ability to bind to DNA and alter its structure. The protein contains two HMG boxes, which are DNA-binding domains that allow it to interact with specific DNA sequences.

Recombinant Human HMG20B Protein also has a C-terminal domain that is involved in protein-protein interactions, allowing it to interact with other regulatory proteins and transcription factors. This unique structure of the protein makes it a versatile molecule that can perform various functions in the cell.

Activity of Recombinant Human HMG20B Protein

The main function of Recombinant Human HMG20B Protein is to regulate gene expression by binding to specific DNA sequences and altering the structure of chromatin. Chromatin is the complex of DNA and proteins that make up the chromosomes in the cell. By binding to specific DNA sequences, HMG20B protein can either activate or repress the expression of nearby genes.

Studies have shown that HMG20B protein plays a crucial role in embryonic development, as well as in the maintenance of stem cells. It has also been linked to the regulation of cell proliferation and differentiation, making it an important protein in various cellular processes.

In addition to its role in gene regulation, Recombinant Human HMG20B Protein has also been found to play a role in DNA repair. It has been shown to interact with other proteins involved in DNA repair, suggesting its involvement in maintaining genomic stability.

Applications of Recombinant Human HMG20B Protein

The unique structure and activity of Recombinant Human HMG20B Protein make it a valuable tool in scientific research and various applications. One of its main applications is in the study of gene regulation and chromatin structure. By using recombinant HMG20B protein, researchers can manipulate the expression of specific genes and study the effects on cellular processes.

Recombinant Human HMG20B Protein has also been used in the development of diagnostic tests and vaccines. Its ability to bind to specific DNA sequences makes it a potential antigen for the detection of autoimmune diseases and the development of targeted vaccines.

Furthermore, the protein has been studied as a potential therapeutic target for various diseases. Its involvement in DNA repair and cell proliferation makes it a promising candidate for the development of treatments for cancer and other genetic disorders.

Conclusion

In summary, Recombinant Human HMG20B Protein is a versatile molecule with a unique structure and important functions in gene regulation and chromatin structure. Its role in various cellular processes and potential applications in research and medicine make it a valuable tool in the scientific community. Further studies on this protein may lead to a better understanding of its functions and potential therapeutic uses.

Recombinant Human HMG20B Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HMG20B Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products