Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CSF3 / G-CSF recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P09919
Molecular weight:
21.28 kDa

$392.00

100ug + 392 loyalty points
His Thr31–Pro207
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CSF3 / G-CSF recombinant protein

Product name Human CSF3 / G-CSF recombinant protein
Uniprot ID P09919
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Molecular weight 21.28 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Pro207
Aliases /Synonyms C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference PX-P6039
Note For research use only
Molecular Constructor
His Thr31–Pro207

Human CSF3 / G-CSF recombinant protein

There are no reviews yet.

Be the first to review “Human CSF3 / G-CSF recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products