Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054)

  • ARO-A13320-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $426.00.Current price is: $305.00.

50ug 28% OFF + 305 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in ELISA Assay
InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in WB Assay

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054)

Product name ARO-A13320-100
Uniprot ID P09919
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference ARO-A13320
Clonality Monoclonal Antibody
Protein Name C17orf33
Product name ARO-A13320-1MG
Uniprot ID P09919
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference ARO-A13320
Clonality Monoclonal Antibody
Protein Name C17orf33
Product name ARO-A13320-50
Uniprot ID P09919
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference ARO-A13320
Clonality Monoclonal Antibody
Protein Name C17orf33

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in ELISA Assay

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in ELISA Assay

Human CSF3 / G-CSF recombinant protein(cat. No.PX-P6039) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) in indirect ELISA with Goat secondary antibody measured by OD450.

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in WB Assay

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in WB Assay

Human CSF3 / G-CSF recombinant protein(cat. No.PX-P6039) can bind InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CSF3/G-CSF (Iv0054)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products