Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human FGF21 (Iv0067)

  • ARO-A13307-100
  • Validated ELISA
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $593.00.Current price is: $436.00.

100ug 26% OFF + 436 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for InVivoMAb Anti-Human FGF21 (Iv0067)
InVivoMAb Anti-Human FGF21 (Iv0067) binds to Human FGF21 recombinant protein in ELISA Assay

InVivoMAb Anti-Human FGF21 (Iv0067)

Product name ARO-A13307-100
Uniprot ID Q9NSA1
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference ARO-A13307
Clonality Monoclonal Antibody
Protein Name FGF21
Product name ARO-A13307-1MG
Uniprot ID Q9NSA1
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference ARO-A13307
Clonality Monoclonal Antibody
Protein Name FGF21
Product name ARO-A13307-50
Uniprot ID Q9NSA1
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference ARO-A13307
Clonality Monoclonal Antibody
Protein Name FGF21

SDS-PAGE for InVivoMAb Anti-Human FGF21 (Iv0067)

SDS-PAGE for InVivoMAb Anti-Human FGF21 (Iv0067)

InVivoMAb Anti-Human FGF21 (Iv0067), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

InVivoMAb Anti-Human FGF21 (Iv0067) binds to Human FGF21 recombinant protein in ELISA Assay

InVivoMAb Anti-Human FGF21 (Iv0067) binds to Human FGF21 recombinant protein in ELISA Assay

Human FGF21 recombinant protein(cat. No.PX-P6445) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human FGF21 (Iv0067) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human FGF21 (Iv0067)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products