Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGDIA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52565
Molecular weight:
17.91 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Asn69–Asp204
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGDIA Protein, N-His

Product name ARO-P12350-100
Uniprot ID P52565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn69-Asp204
Aliases /Synonyms Rho GDP-dissociation inhibitor 1, GDIA1, Rho GDI 1, Rho-GDI alpha, ARHGDIA
Reference ARO-P12350
Note For research use only.
Molecular Constructor
Asn69–Asp204
Product name ARO-P12350-1MG
Uniprot ID P52565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn69-Asp204
Aliases /Synonyms Rho GDP-dissociation inhibitor 1, GDIA1, Rho GDI 1, Rho-GDI alpha, ARHGDIA
Reference ARO-P12350
Note For research use only.
Molecular Constructor
Asn69–Asp204
Product name ARO-P12350-50
Uniprot ID P52565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn69-Asp204
Aliases /Synonyms Rho GDP-dissociation inhibitor 1, GDIA1, Rho GDI 1, Rho-GDI alpha, ARHGDIA
Reference ARO-P12350
Note For research use only.
Molecular Constructor
Asn69–Asp204

Introduction to Recombinant Human ARHGDIA Protein

Recombinant Human ARHGDIA Protein, also known as Rho GDP-dissociation inhibitor 1 (RhoGDI1), is a protein that plays a crucial role in regulating the activity of Rho GTPases. These proteins are important for various cellular processes, including cell growth, movement, and differentiation. The ARHGDIA gene is located on chromosome 17 and codes for a 204 amino acid protein with a molecular weight of approximately 23 kDa.

Structure of Recombinant Human ARHGDIA Protein

The structure of Recombinant Human ARHGDIA Protein consists of three distinct domains: the N-terminal domain, the middle domain, and the C-terminal domain. The N-terminal domain is responsible for binding to Rho GTPases, while the middle domain regulates the activity of the protein. The C-terminal domain is involved in the interaction with other proteins and is crucial for the proper functioning of ARHGDIA.

The N-terminal domain of ARHGDIA contains a hydrophobic pocket that binds to the lipid moiety of Rho GTPases, thereby inhibiting their activity. The middle domain is composed of two alpha helices and a beta sheet, which form a “claw-like” structure that interacts with the N-terminal domain. The C-terminal domain contains a conserved sequence that is essential for the binding of ARHGDIA to Rho GTPases.

Activity of Recombinant Human ARHGDIA Protein

Recombinant Human ARHGDIA Protein acts as a negative regulator of Rho GTPases by inhibiting their activity. Rho GTPases are molecular switches that cycle between an active GTP-bound state and an inactive GDP-bound state. These proteins play a crucial role in various cellular processes, including cell migration, adhesion, and cytoskeletal organization.

ARHGDIA binds to the lipid moiety of Rho GTPases, thereby preventing their activation by guanine nucleotide exchange factors (GEFs). GEFs promote the exchange of GDP for GTP, which leads to the activation of Rho GTPases. By inhibiting this process, ARHGDIA effectively blocks the activity of Rho GTPases and regulates their function in the cell.

Application of Recombinant Human ARHGDIA Protein

Recombinant Human ARHGDIA Protein has various applications in both research and medical fields. Some of the key applications of this protein include:

1. Regulation of cell migration and invasion

ARHGDIA plays a crucial role in regulating cell migration and invasion by inhibiting the activity of Rho GTPases. Dysregulation of Rho GTPases has been linked to various diseases, including cancer, making ARHGDIA an important therapeutic target for cancer treatment.

2. Study of cellular processes

Recombinant Human ARHGDIA Protein is widely used in research to study the role of Rho GTPases in various cellular processes. By inhibiting the activity of Rho GTPases, ARHGDIA allows researchers to investigate the specific functions of these proteins in different cellular pathways.

3. Drug discovery and development

ARHGDIA has been identified as a potential therapeutic target for various diseases, including cancer, cardiovascular diseases, and neurological disorders. Recombinant Human ARHGDIA Protein is used in drug discovery and development to identify small molecules that can modulate its activity and potentially treat these diseases.

4. Diagnostic tool

Alterations in the expression and activity of ARHGDIA have been observed in various diseases, including cancer, making it a potential diagnostic biomarker. Recombinant Human ARHGDIA Protein can be used as a diagnostic

Recombinant Human ARHGDIA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGDIA Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products