Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human POFUT2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2G5
Molecular weight:
15.99 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Pro53–Tyr167
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human POFUT2 Protein, N-His

Product name ARO-P10653-100
Uniprot ID Q9Y2G5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro53-Tyr167
Aliases /Synonyms POFUT2, FUT13, Peptide-O-fucosyltransferase 2, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, C21orf80, O-FucT-2
Reference ARO-P10653
Note For research use only.
Molecular Constructor
Pro53–Tyr167
Product name ARO-P10653-1MG
Uniprot ID Q9Y2G5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro53-Tyr167
Aliases /Synonyms POFUT2, FUT13, Peptide-O-fucosyltransferase 2, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, C21orf80, O-FucT-2
Reference ARO-P10653
Note For research use only.
Molecular Constructor
Pro53–Tyr167
Product name ARO-P10653-50
Uniprot ID Q9Y2G5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro53-Tyr167
Aliases /Synonyms POFUT2, FUT13, Peptide-O-fucosyltransferase 2, GDP-fucose protein O-fucosyltransferase 2, KIAA0958, C21orf80, O-FucT-2
Reference ARO-P10653
Note For research use only.
Molecular Constructor
Pro53–Tyr167

Introduction

Recombinant Human POFUT2 Protein, also known as Protein O-Fucosyltransferase 2, is a key enzyme involved in the post-translational modification of proteins. This protein is encoded by the POFUT2 gene and is responsible for adding fucose molecules to specific serine or threonine residues on target proteins, a process known as O-fucosylation. O-fucosylation plays a crucial role in the proper folding, stability, and function of many proteins, making POFUT2 an essential enzyme in various biological processes.

Structure of Recombinant Human POFUT2 Protein

The recombinant form of POFUT2 is a 47 kDa protein consisting of 416 amino acids. It contains a signal peptide at the N-terminus, followed by a catalytic domain and a transmembrane domain. The catalytic domain of POFUT2 is highly conserved among different species, indicating its importance in protein function. The transmembrane domain anchors the protein to the endoplasmic reticulum (ER) membrane, where it carries out its function.

Activity of Recombinant Human POFUT2 Protein

The main function of POFUT2 is to add fucose molecules to the O-linked glycosylation sites of target proteins. This process involves the transfer of fucose from GDP-fucose to the target protein, which is catalyzed by the catalytic domain of POFUT2. This modification is crucial for the proper folding and stability of many proteins, including Notch receptors, thrombospondin type 1 repeats, and epidermal growth factor-like domains. POFUT2 has also been shown to play a role in regulating the activity of various proteins, such as Wnt signaling pathway components and the extracellular matrix protein versican.

Application of Recombinant Human POFUT2 Protein

Recombinant Human POFUT2 Protein has a wide range of applications in both research and therapeutic fields. Its ability to modify various proteins makes it a valuable tool for studying the role of O-fucosylation in different biological processes. POFUT2 is also being studied as a potential therapeutic target for diseases associated with abnormal protein folding, such as cancer and neurodegenerative disorders. In addition, POFUT2 has been identified as a potential biomarker for certain types of cancer, making it a promising candidate for diagnostic and prognostic purposes.

Recombinant Human POFUT2 Protein as an Antigen

The recombinant form of POFUT2 has also been used as an antigen in various studies. It has been shown to induce a strong immune response and can be used to generate specific antibodies against POFUT2. These antibodies can then be used for various applications, such as detecting POFUT2 expression in different tissues and investigating its role in disease progression.

Conclusion

In summary, Recombinant Human POFUT2 Protein is a crucial enzyme involved in the O-fucosylation of target proteins. Its structure and activity make it an essential player in many biological processes, and its potential applications in research and therapy make it a valuable tool for scientists. Further studies on POFUT2 and its role in different diseases may lead to the development of novel therapeutic strategies and diagnostic tools.

Recombinant Human POFUT2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human POFUT2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products