Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IFT43 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96FT9
Molecular weight:
24.57 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Ile103–Thr208
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IFT43 Protein, N-His-SUMO

Product name ARO-P11149-100
Uniprot ID Q96FT9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Molecular weight 24.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile103-Thr208
Aliases /Synonyms C14orf179, IFT43, Intraflagellar transport protein 43 homolog
Reference ARO-P11149
Note For research use only.
Molecular Constructor
Ile103–Thr208
Product name ARO-P11149-1MG
Uniprot ID Q96FT9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Molecular weight 24.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile103-Thr208
Aliases /Synonyms C14orf179, IFT43, Intraflagellar transport protein 43 homolog
Reference ARO-P11149
Note For research use only.
Molecular Constructor
Ile103–Thr208
Product name ARO-P11149-50
Uniprot ID Q96FT9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
Molecular weight 24.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile103-Thr208
Aliases /Synonyms C14orf179, IFT43, Intraflagellar transport protein 43 homolog
Reference ARO-P11149
Note For research use only.
Molecular Constructor
Ile103–Thr208

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of a specific protein. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and research. One such important recombinant protein is the Recombinant Human IFT43 Protein. In this article, we will explore the structure, activity, and applications of this protein.

Structure of Recombinant Human IFT43 Protein

The Recombinant Human IFT43 Protein is a 43 kDa protein that is encoded by the IFT43 gene. It belongs to the intraflagellar transport (IFT) protein family, which plays a crucial role in the formation and maintenance of cilia, hair-like structures found on the surface of many cells. The protein is composed of 399 amino acids and has a conserved WD40 repeat domain, which is responsible for its function in the IFT complex.

The IFT complex is a large protein complex that is responsible for the transport of proteins and other molecules within the cilia. The Recombinant Human IFT43 Protein is a subunit of this complex and is essential for its proper functioning. It interacts with other subunits of the IFT complex, such as IFT20 and IFT88, to facilitate the transport of cargo proteins along the ciliary axoneme.

Activity of Recombinant Human IFT43 Protein

The main activity of the Recombinant Human IFT43 Protein is its role in the intraflagellar transport process. This process is essential for the assembly and maintenance of cilia, which have diverse functions in different cell types. Cilia are involved in various cellular processes, such as sensing, motility, and signaling. Dysfunction of cilia has been linked to a wide range of human diseases, collectively known as ciliopathies. These include polycystic kidney disease, retinal degeneration, and developmental disorders.

The Recombinant Human IFT43 Protein plays a critical role in the transport of proteins and other molecules along the ciliary axoneme. It forms a complex with other subunits of the IFT complex and acts as a motor protein, using ATP hydrolysis to power the movement of cargo proteins. This transport process is crucial for the proper functioning of cilia and the maintenance of cellular homeostasis.

Application of Recombinant Human IFT43 Protein

The Recombinant Human IFT43 Protein has a wide range of applications in various fields, including medicine, biotechnology, and research. One of its main applications is in the study of cilia and ciliopathies. Researchers can use this protein to study the role of IFT complex in ciliary transport and its dysfunction in ciliopathies. It can also be used to investigate the molecular mechanisms of ciliogenesis and ciliary signaling pathways.

In addition, the Recombinant Human IFT43 Protein has potential therapeutic applications. As ciliopathies are associated with defects in ciliary transport, this protein can be used as a therapeutic target for the treatment of ciliopathy-related diseases. Furthermore, it can also be used in drug discovery and development, as targeting the IFT complex and ciliary transport process can lead to the development of novel treatments for ciliopathies.

Conclusion

In conclusion, the Recombinant Human IFT43 Protein is a crucial protein involved in the intraflagellar transport process. It plays a critical role in the assembly and maintenance of cilia, which have diverse functions in different cell types. This protein has various applications in the study of cilia and ciliopathies, as well as potential therapeutic applications. With further research and development, the Recombinant Human IFT43 Protein has the potential to contribute to the

Recombinant Human IFT43 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human IFT43 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products