Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZY9
Molecular weight:
23.71 kDa

Original price was: $328.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Ala2–Lys91
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep

Product name ARO-P12338-100
Uniprot ID Q9BZY9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRK
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys91
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM31, TRIM31, Tripartite motif-containing protein 31, C6orf13, RNF, RING-type E3 ubiquitin transferase TRIM31
Reference ARO-P12338
Note For research use only.
Molecular Constructor
Ala2–Lys91
Product name ARO-P12338-1MG
Uniprot ID Q9BZY9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRK
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys91
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM31, TRIM31, Tripartite motif-containing protein 31, C6orf13, RNF, RING-type E3 ubiquitin transferase TRIM31
Reference ARO-P12338
Note For research use only.
Molecular Constructor
Ala2–Lys91
Product name ARO-P12338-50
Uniprot ID Q9BZY9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRK
Molecular weight 23.71 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys91
Aliases /Synonyms E3 ubiquitin-protein ligase TRIM31, TRIM31, Tripartite motif-containing protein 31, C6orf13, RNF, RING-type E3 ubiquitin transferase TRIM31
Reference ARO-P12338
Note For research use only.
Molecular Constructor
Ala2–Lys91

Title: Introduction to Recombinant Human TRIM31 Protein: A Versatile Antigen for Research and Therapeutic Applications

Recombinant Human TRIM31 Protein: Structure and Function

The human TRIM31 (tripartite motif-containing 31) protein is a member of the tripartite motif (TRIM) family of proteins, characterized by the presence of a RING (Really Interesting New Gene) domain, a B-box domain, and a coiled-coil domain. TRIM31 is a 56 kDa protein consisting of 490 amino acids and is predominantly expressed in the cytoplasm of various tissues, including immune cells, brain, and heart.

TRIM31 has been shown to play a crucial role in regulating various cellular processes, such as protein degradation, cell proliferation, and immune response. It functions as an E3 ubiquitin ligase, which catalyzes the transfer of ubiquitin molecules onto target proteins, leading to their degradation via the proteasome pathway. Additionally, TRIM31 has been reported to interact with various signaling molecules and transcription factors, suggesting its involvement in multiple signaling pathways.

Recombinant Human TRIM31 Protein: Production and Purification

Recombinant proteins are artificially produced proteins that are derived from the genetic material of a different organism. Recombinant Human TRIM31 Protein is produced using recombinant DNA technology, where the gene encoding TRIM31 is cloned into an expression vector and introduced into a host cell, such as E. coli or yeast. The host cell then produces large quantities of the protein, which can be easily purified using chromatography techniques.

Recombinant Human TRIM31 Protein: Applications in Research

Due to its diverse functions and interactions, TRIM31 has been implicated in various diseases, including cancer, autoimmune disorders, and viral infections. Recombinant Human TRIM31 Protein has been widely used as a research tool to study the role of TRIM31 in these diseases. It has been shown to regulate the activity of key signaling molecules, such as NF-κB and STAT3, which are involved in cancer progression and immune response.

Moreover, recombinant TRIM31 protein has been used to investigate the role of TRIM31 in viral infections, particularly in HIV and influenza. Studies have shown that TRIM31 can inhibit the replication of these viruses by targeting viral proteins for degradation. This highlights the potential of TRIM31 as a therapeutic target for antiviral therapy.

Recombinant Human TRIM31 Protein: Therapeutic Applications

The unique structure and function of TRIM31 make it a promising candidate for therapeutic applications. Its E3 ubiquitin ligase activity and ability to regulate immune response make it an attractive target for the development of novel immunotherapies. For instance, recombinant TRIM31 protein has been used to stimulate the immune response against cancer cells, leading to their destruction.

Furthermore, TRIM31 has been shown to play a role in the development of autoimmune disorders, such as rheumatoid arthritis and systemic lupus erythematosus. Recombinant Human TRIM31 Protein has been used in preclinical studies to inhibit the activity of TRIM31, leading to a reduction in disease symptoms. This highlights the potential of TRIM31 as a therapeutic target for autoimmune diseases.

In conclusion, Recombinant Human TRIM31 Protein is a versatile antigen that has been extensively studied for its role in various cellular processes and diseases. Its structure, function, and potential therapeutic applications make it a valuable tool for both research and therapeutic purposes. With ongoing studies and advancements in recombinant protein technology, the potential of TRIM31 as a therapeutic target continues to grow, offering hope for the development of novel treatments for various diseases.

Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human TRIM31 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products