Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL16 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14005
Molecular weight:
24.94 kDa

Original price was: $318.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Ser1080–Arg1196
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL16 Protein, N-His-SUMO

Product name ARO-P11140-100
Uniprot ID Q14005
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTR
Molecular weight 24.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1080-Arg1196
Aliases /Synonyms LCF, IL-16, Lymphocyte chemoattractant factor, IL16, Pro-interleukin-16
Reference ARO-P11140
Note For research use only.
Molecular Constructor
Ser1080–Arg1196
Product name ARO-P11140-1MG
Uniprot ID Q14005
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTR
Molecular weight 24.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1080-Arg1196
Aliases /Synonyms LCF, IL-16, Lymphocyte chemoattractant factor, IL16, Pro-interleukin-16
Reference ARO-P11140
Note For research use only.
Molecular Constructor
Ser1080–Arg1196
Product name ARO-P11140-50
Uniprot ID Q14005
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SVISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTR
Molecular weight 24.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser1080-Arg1196
Aliases /Synonyms LCF, IL-16, Lymphocyte chemoattractant factor, IL16, Pro-interleukin-16
Reference ARO-P11140
Note For research use only.
Molecular Constructor
Ser1080–Arg1196

Introduction to Recombinant Human IL16 Protein

Recombinant Human IL16 Protein, also known as interleukin-16, is a cytokine that plays a vital role in the immune system. It is a glycoprotein that is produced by activated CD8+ T cells and functions as a chemoattractant for various immune cells. In this article, we will explore the structure, activity, and applications of Recombinant Human IL16 Protein.

Structure of Recombinant Human IL16 Protein

Recombinant Human IL16 Protein is a 130 amino acid protein with a molecular weight of approximately 14 kDa. It is composed of four alpha-helices and two beta-sheets, which form a compact globular structure. The protein also contains two potential N-glycosylation sites, which can affect its biological activity.

The gene encoding Recombinant Human IL16 Protein is located on chromosome 15 in humans and is highly conserved among different species. The primary structure of the protein is similar to other cytokines, but it has a unique C-terminal domain that is responsible for its chemoattractant activity.

Activity of Recombinant Human IL16 Protein

Recombinant Human IL16 Protein is a potent chemoattractant for various immune cells, including CD4+ T cells, monocytes, macrophages, and dendritic cells. It also has the ability to stimulate the production of other cytokines, such as IL-2 and IL-8, by these cells.

The chemoattractant activity of Recombinant Human IL16 Protein is mediated by its binding to the CD4 receptor, which is present on the surface of immune cells. This binding triggers a signaling cascade that leads to the migration of immune cells towards the site of inflammation or infection.

In addition to its chemotactic properties, Recombinant Human IL16 Protein also has immunomodulatory effects. It can inhibit the proliferation of CD4+ T cells and induce apoptosis in these cells. This makes it a potential therapeutic target for diseases involving abnormal CD4+ T cell proliferation, such as autoimmune disorders and certain types of cancer.

Applications of Recombinant Human IL16 Protein

Due to its diverse activities, Recombinant Human IL16 Protein has several potential applications in both research and clinical settings. One of the main uses of this protein is in studying the immune response and inflammation. Its ability to attract and modulate the activity of immune cells makes it a valuable tool for understanding the mechanisms of various diseases.

Recombinant Human IL16 Protein has also been investigated as a potential therapeutic agent. In preclinical studies, it has shown promising results in treating inflammatory diseases, such as rheumatoid arthritis and multiple sclerosis. It has also been studied as a potential anti-cancer agent, as it can inhibit the growth of certain types of cancer cells.

Furthermore, Recombinant Human IL16 Protein has been used in diagnostic assays to measure the levels of this cytokine in biological samples. Elevated levels of IL-16 have been associated with various inflammatory conditions, making it a potential biomarker for disease diagnosis and monitoring.

Conclusion

In summary, Recombinant Human IL16 Protein is a cytokine with diverse activities in the immune system. Its structure, activity, and potential applications make it a valuable tool for studying immune responses and developing therapeutic interventions for various diseases. With ongoing research, this protein may hold even more promise for future medical advancements.

Recombinant Human IL16 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human IL16 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products