Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human IL22, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9GZX6
Molecular weight:
19.06 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Ala34–Ile179
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human IL22, N-His

Product name ARO-P13120-100
Uniprot ID Q9GZX6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Molecular weight 19.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala34-Ile179
Aliases /Synonyms Interleukin-22, Cytokine Zcyto18, IL-22, ZCYTO18, IL22, ILTIF, IL-TIF, IL-10-related T-cell-derived-inducible factor
Reference ARO-P13120
Note For research use only.
Molecular Constructor
Ala34–Ile179
Product name ARO-P13120-1MG
Uniprot ID Q9GZX6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Molecular weight 19.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala34-Ile179
Aliases /Synonyms Interleukin-22, Cytokine Zcyto18, IL-22, ZCYTO18, IL22, ILTIF, IL-TIF, IL-10-related T-cell-derived-inducible factor
Reference ARO-P13120
Note For research use only.
Molecular Constructor
Ala34–Ile179
Product name ARO-P13120-50
Uniprot ID Q9GZX6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Molecular weight 19.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala34-Ile179
Aliases /Synonyms Interleukin-22, Cytokine Zcyto18, IL-22, ZCYTO18, IL22, ILTIF, IL-TIF, IL-10-related T-cell-derived-inducible factor
Reference ARO-P13120
Note For research use only.
Molecular Constructor
Ala34–Ile179

SDS-PAGE for Recombinant Human IL22, N-His

SDS-PAGE for Recombinant Human IL22, N-His

Recombinant Human IL22, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human IL22, N-His

There are no reviews yet.

Be the first to review “Recombinant Human IL22, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products