Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ITLN1/Omentin, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WWA0
Molecular weight:
27.18 kDa

Original price was: $393.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Cys31–Gly253
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ITLN1/Omentin, N-His

Product name ARO-P13218-100
Uniprot ID Q8WWA0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAG
Molecular weight 27.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys31-Gly253
Aliases /Synonyms INTL, ITLN-1, Intestinal lactoferrin receptor, ITLN, LFR, Intelectin-1, ITLN1, Omentin, Galactofuranose-binding lectin, Endothelial lectin HL-1
Reference ARO-P13218
Note For research use only.
Molecular Constructor
Cys31–Gly253
Product name ARO-P13218-1MG
Uniprot ID Q8WWA0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAG
Molecular weight 27.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys31-Gly253
Aliases /Synonyms INTL, ITLN-1, Intestinal lactoferrin receptor, ITLN, LFR, Intelectin-1, ITLN1, Omentin, Galactofuranose-binding lectin, Endothelial lectin HL-1
Reference ARO-P13218
Note For research use only.
Molecular Constructor
Cys31–Gly253
Product name ARO-P13218-50
Uniprot ID Q8WWA0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAG
Molecular weight 27.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys31-Gly253
Aliases /Synonyms INTL, ITLN-1, Intestinal lactoferrin receptor, ITLN, LFR, Intelectin-1, ITLN1, Omentin, Galactofuranose-binding lectin, Endothelial lectin HL-1
Reference ARO-P13218
Note For research use only.
Molecular Constructor
Cys31–Gly253

Structure of Recombinant Human ITLN1/Omentin

Recombinant Human ITLN1, also known as Omentin, is a protein that is produced through genetic engineering techniques. It is a member of the interleukin-like (ITLN) family, which is a group of proteins that are structurally similar to interleukins, but have different functions. The gene that codes for ITLN1 is located on chromosome 1 in humans and is expressed in various tissues, including adipose tissue, liver, and intestine.

The mature form of Recombinant Human ITLN1 is a 313 amino acid protein with a molecular weight of approximately 34 kDa. It has a unique structure consisting of a signal peptide, an N-terminal domain, a C-terminal domain, and a central domain. The N-terminal domain contains a carbohydrate recognition domain (CRD), which is responsible for binding to carbohydrates on the surface of cells. The central domain is rich in cysteine residues, which form disulfide bonds that contribute to the stability of the protein. The C-terminal domain is highly variable among different species and is thought to be involved in protein-protein interactions.

Activity of Recombinant Human ITLN1/Omentin

Recombinant Human ITLN1 has been shown to have multiple activities in the body. It is primarily known for its role in regulating glucose and lipid metabolism, as well as its anti-inflammatory effects. Studies have shown that ITLN1 can improve insulin sensitivity and glucose uptake in adipose tissue and skeletal muscle. It also has the ability to decrease the production of pro-inflammatory cytokines, such as TNF-α and IL-6, and increase the production of anti-inflammatory cytokines, such as IL-10.

In addition to its metabolic and anti-inflammatory effects, Recombinant Human ITLN1 has also been shown to have a role in cardiovascular health. It can regulate blood pressure by promoting vasodilation and inhibiting the proliferation of smooth muscle cells in blood vessels. It also has anti-atherosclerotic properties, as it can decrease the accumulation of lipids in arterial walls.

Application of Recombinant Human ITLN1/Omentin

Recombinant Human ITLN1 has potential therapeutic applications in various diseases. Its role in regulating glucose and lipid metabolism makes it a promising candidate for the treatment of type 2 diabetes and obesity. Studies have shown that ITLN1 levels are decreased in individuals with these conditions, and supplementation with Recombinant Human ITLN1 has been shown to improve glucose tolerance and decrease body weight in animal models.

The anti-inflammatory effects of ITLN1 also make it a potential therapeutic target for inflammatory diseases, such as rheumatoid arthritis and inflammatory bowel disease. It has been shown to decrease inflammation in these conditions and may have a role in reducing disease severity.

Furthermore, Recombinant Human ITLN1 has potential applications in cardiovascular diseases. Its ability to regulate blood pressure and inhibit atherosclerosis makes it a potential treatment for hypertension and atherosclerosis.

In conclusion, Recombinant Human ITLN1, also known as Omentin, is a structurally unique protein with multiple activities in the body. Its role in regulating glucose and lipid metabolism, as well as its anti-inflammatory and cardiovascular effects, make it a promising candidate for the treatment of various diseases. Further research and clinical trials are needed to fully understand the potential of Recombinant Human ITLN1 in therapeutic applications.

Recombinant Human ITLN1/Omentin, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ITLN1/Omentin, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products