Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human KNL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NG31
Molecular weight:
26.45 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Ser2131–Asp2337
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human KNL1 Protein, N-His

Recombinant Human KNL1 Protein, N-His

Product name ARO-P10720-100
Uniprot ID Q8NG31
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2131-Asp2337
Aliases /Synonyms Blinkin, CT29, Kinetochore-null protein 1, Cancer/testis antigen 29, Bub-linking kinetochore protein, Protein CASC5, Protein D40/AF15q14, ALL1-fused gene from chromosome 15q14 protein, Kinetochore scaffold 1, CASC5, KNL1, Cancer susceptibility candidate gene 5 protein, KIAA1570, AF15q14
Reference ARO-P10720
Note For research use only.
Molecular Constructor
Ser2131–Asp2337
Product name ARO-P10720-1MG
Uniprot ID Q8NG31
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2131-Asp2337
Aliases /Synonyms Blinkin, CT29, Kinetochore-null protein 1, Cancer/testis antigen 29, Bub-linking kinetochore protein, Protein CASC5, Protein D40/AF15q14, ALL1-fused gene from chromosome 15q14 protein, Kinetochore scaffold 1, CASC5, KNL1, Cancer susceptibility candidate gene 5 protein, KIAA1570, AF15q14
Reference ARO-P10720
Note For research use only.
Molecular Constructor
Ser2131–Asp2337
Product name ARO-P10720-50
Uniprot ID Q8NG31
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SLSEWDVVEWSDDQAVFTFVYDTIQLTITFEESVVGFPFLDKRYRKIVDVNFQSLLDEDQAPPSSLLVHKLIFQYVEEKESWKKTCTTQHQLPKMLEEFSLVVHHCRLLGEEIEYLKRWGPNYNLMNIDINNNELRLLFSSSAAFAKFEITLFLSAYYPSVPLPSTIQNHVGNTSQDDIATILSKVPLENNYLKNVVKQIYQDLFQD
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2131-Asp2337
Aliases /Synonyms Blinkin, CT29, Kinetochore-null protein 1, Cancer/testis antigen 29, Bub-linking kinetochore protein, Protein CASC5, Protein D40/AF15q14, ALL1-fused gene from chromosome 15q14 protein, Kinetochore scaffold 1, CASC5, KNL1, Cancer susceptibility candidate gene 5 protein, KIAA1570, AF15q14
Reference ARO-P10720
Note For research use only.
Molecular Constructor
Ser2131–Asp2337

Recombinant Human KNL1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human KNL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products