Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FETUB, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UGM5
Molecular weight:
38.56 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Met149–Asp255
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FETUB, N-GST

Product name ARO-P12899-100
Uniprot ID Q9UGM5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCD
Molecular weight 38.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met149-Asp255
Aliases /Synonyms 16G2, Fetuin-B, Gugu, FETUB, Fetuin-like protein IRL685
Reference ARO-P12899
Note For research use only.
Molecular Constructor
Met149–Asp255
Product name ARO-P12899-1MG
Uniprot ID Q9UGM5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCD
Molecular weight 38.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met149-Asp255
Aliases /Synonyms 16G2, Fetuin-B, Gugu, FETUB, Fetuin-like protein IRL685
Reference ARO-P12899
Note For research use only.
Molecular Constructor
Met149–Asp255
Product name ARO-P12899-50
Uniprot ID Q9UGM5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTCPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCD
Molecular weight 38.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met149-Asp255
Aliases /Synonyms 16G2, Fetuin-B, Gugu, FETUB, Fetuin-like protein IRL685
Reference ARO-P12899
Note For research use only.
Molecular Constructor
Met149–Asp255

Introduction to Recombinant Human FETUB

Recombinant Human FETUB is a protein that is produced through recombinant DNA technology, where the gene for human FETUB is inserted into a host cell, typically a bacterial or yeast cell, to produce large quantities of the protein for research and therapeutic purposes. FETUB, also known as fetuin-B, is a glycoprotein that is primarily produced by the liver and has been found to play a role in various physiological processes.

Structure of Recombinant Human FETUB

Recombinant Human FETUB is a 349 amino acid protein with a molecular weight of approximately 38 kDa. It is composed of two distinct domains, an N-terminal cystatin-like domain and a C-terminal fetuin-A-like domain. The N-terminal domain is responsible for inhibiting cysteine proteases, while the C-terminal domain is involved in calcium binding and has been shown to interact with various proteins and receptors.

Recombinant Human FETUB also contains multiple glycosylation sites, which contribute to its stability and function. These glycans can vary in structure and have been found to affect the activity and binding properties of FETUB.

Activity of Recombinant Human FETUB

The primary function of FETUB is still not fully understood, but studies have shown that it plays a role in regulating insulin sensitivity, lipid metabolism, and inflammation. It has also been implicated in various diseases, including diabetes, obesity, and cardiovascular diseases.

One of the key activities of FETUB is its ability to inhibit cysteine proteases, such as cathepsins, which are involved in various cellular processes, including cell death and immune response. This inhibition is mediated by the N-terminal cystatin-like domain of FETUB.

Additionally, FETUB has been found to interact with various proteins and receptors, including the Wnt signaling pathway and the insulin receptor. These interactions suggest that FETUB may play a role in regulating cell signaling and metabolism.

Application of Recombinant Human FETUB

Recombinant Human FETUB has a wide range of potential applications in both research and therapeutic settings. Its ability to inhibit cysteine proteases makes it a valuable tool for studying protease-mediated processes, such as cell death and immune response. It can also be used to study the role of FETUB in various diseases, particularly those related to insulin resistance and inflammation.

Moreover, FETUB has been investigated as a potential biomarker for various diseases, including diabetes and cardiovascular diseases. Its levels have been found to be elevated in individuals with these conditions, making it a potential diagnostic or prognostic marker.

In terms of therapeutic applications, FETUB has been studied as a potential target for drug development. Its role in regulating insulin sensitivity and inflammation makes it a promising target for treating diseases such as diabetes and obesity. Recombinant Human FETUB can also be used to develop FETUB-based therapies, such as FETUB replacement therapy, to potentially treat diseases associated with FETUB deficiency.

Conclusion

In summary, Recombinant Human FETUB is a protein that has been produced through recombinant DNA technology and has a complex structure with multiple functional domains and glycosylation sites. It plays a role in regulating insulin sensitivity, lipid metabolism, and inflammation, and has potential applications in research and therapeutics. Further studies on FETUB are needed to fully understand its function and potential as a therapeutic target.

Recombinant Human FETUB, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human FETUB, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products