Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human KRT12 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99456
Molecular weight:
22.81 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Gly103–Gln199
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human KRT12 Protein, N-His-SUMO

Product name ARO-P11230-100
Uniprot ID Q99456
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASI
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Gln199
Aliases /Synonyms Keratin-12, Keratin, type I cytoskeletal 12, Cytokeratin-12, K12, CK-12, KRT12
Reference ARO-P11230
Note For research use only.
Molecular Constructor
Gly103–Gln199
Product name ARO-P11230-1MG
Uniprot ID Q99456
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASI
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Gln199
Aliases /Synonyms Keratin-12, Keratin, type I cytoskeletal 12, Cytokeratin-12, K12, CK-12, KRT12
Reference ARO-P11230
Note For research use only.
Molecular Constructor
Gly103–Gln199
Product name ARO-P11230-50
Uniprot ID Q99456
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSPGGGSLGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNKIISASI
Molecular weight 22.81 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Gln199
Aliases /Synonyms Keratin-12, Keratin, type I cytoskeletal 12, Cytokeratin-12, K12, CK-12, KRT12
Reference ARO-P11230
Note For research use only.
Molecular Constructor
Gly103–Gln199

Introduction

Recombinant Human KRT12 Protein, also known as Keratin 12, is a type of protein that is produced through genetic engineering techniques. It is a member of the keratin family of proteins, which are the major structural proteins found in epithelial cells. This protein plays a crucial role in maintaining the structural integrity and function of the cornea, the transparent front part of the eye. In this article, we will explore the structure, activity, and applications of Recombinant Human KRT12 Protein.

Structure of Recombinant Human KRT12 Protein

Recombinant Human KRT12 Protein is a 53 kDa protein that is composed of 490 amino acids. It is coded by the KRT12 gene, which is located on chromosome 17 in humans. The primary structure of this protein consists of a long chain of amino acids that are arranged in a specific sequence. This sequence determines the three-dimensional structure of the protein, which is crucial for its function.

The secondary structure of Recombinant Human KRT12 Protein is mainly composed of alpha-helices and beta-sheets. These secondary structures are stabilized by hydrogen bonds between the amino acid residues. The tertiary structure of this protein is a coiled-coil structure, which is formed by the folding of the secondary structures. This structure is essential for the stability and function of the protein.

Activity of Recombinant Human KRT12 Protein

Recombinant Human KRT12 Protein is primarily expressed in the corneal epithelium, the outermost layer of the cornea. It is responsible for maintaining the structural integrity and transparency of the cornea. This protein forms a network of filaments, along with other keratins, that provide mechanical strength to the corneal cells. It also plays a crucial role in cell adhesion and migration, which is essential for the healing of corneal wounds.

Mutations in the KRT12 gene can lead to a condition called Meesmann’s corneal dystrophy, which is characterized by the formation of small cysts in the corneal epithelium. These mutations can affect the structure and function of Recombinant Human KRT12 Protein, leading to impaired corneal function. Therefore, this protein is vital for maintaining the health and function of the cornea.

Applications of Recombinant Human KRT12 Protein

Recombinant Human KRT12 Protein has various applications in the field of ophthalmology. It can be used in the production of artificial corneas, which are used to replace damaged or diseased corneas. These artificial corneas are made by seeding corneal cells onto a scaffold made of recombinant proteins, including Recombinant Human KRT12 Protein. This scaffold provides structural support and promotes the growth and differentiation of corneal cells.

In addition, Recombinant Human KRT12 Protein can also be used in the development of drugs for the treatment of corneal diseases. By understanding the structure and function of this protein, researchers can design drugs that target specific mutations in the KRT12 gene, which can help in the treatment of Meesmann’s corneal dystrophy and other corneal disorders.

Conclusion

Recombinant Human KRT12 Protein is an essential protein that plays a crucial role in maintaining the structure and function of the cornea. Its structure, activity, and applications have been extensively studied and have led to significant advancements in the field of ophthalmology. With further research and development, this protein has the potential to be used in the treatment of various corneal disorders, providing hope for patients with these conditions.

Recombinant Human KRT12 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human KRT12 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products