Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LDLR Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P01130
Molecular weight:
67.11 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Gly193–Arg788
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LDLR Protein, C-His

Product name ARO-P10402-100
Uniprot ID P01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSV
Molecular weight 67.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly193-Arg788
Aliases /Synonyms LDLR, Low-density lipoprotein receptor, LDL receptor
Reference ARO-P10402
Note For research use only.
Molecular Constructor
Gly193–Arg788
Product name ARO-P10402-1MG
Uniprot ID P01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSV
Molecular weight 67.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly193-Arg788
Aliases /Synonyms LDLR, Low-density lipoprotein receptor, LDL receptor
Reference ARO-P10402
Note For research use only.
Molecular Constructor
Gly193–Arg788
Product name ARO-P10402-50
Uniprot ID P01130
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSV
Molecular weight 67.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly193-Arg788
Aliases /Synonyms LDLR, Low-density lipoprotein receptor, LDL receptor
Reference ARO-P10402
Note For research use only.
Molecular Constructor
Gly193–Arg788

The Structure of Recombinant Human LDLR Protein

Recombinant Human LDLR Protein, also known as low-density lipoprotein receptor protein, is a type I transmembrane glycoprotein that plays a crucial role in the regulation of cholesterol homeostasis in the body. This protein is composed of 839 amino acids and has a molecular weight of approximately 160 kDa. It is primarily expressed in the liver, but can also be found in other tissues such as the brain, heart, and adrenal glands.

The structure of Recombinant Human LDLR Protein consists of four main domains: the extracellular domain, the transmembrane domain, the cytoplasmic domain, and the O-linked glycosylation domain. The extracellular domain is the largest part of the protein, comprising of approximately 80% of its total length. It is responsible for binding to low-density lipoprotein (LDL) particles and mediating their uptake into cells.

The transmembrane domain is a hydrophobic stretch of amino acids that anchors the protein to the cell membrane. It is composed of 22 amino acids and is essential for the proper functioning of the protein. The cytoplasmic domain, on the other hand, is the smallest domain of Recombinant Human LDLR Protein and is located inside the cell. It plays a crucial role in regulating the internalization and recycling of the protein.

The O-linked glycosylation domain is responsible for the addition of sugar molecules to the protein, which is important for its stability and proper folding. This domain also plays a role in the recognition and binding of LDL particles.

The Activity of Recombinant Human LDLR Protein

The primary function of Recombinant Human LDLR Protein is to regulate the levels of cholesterol in the body. It does this by binding to LDL particles, which are responsible for transporting cholesterol in the blood. When LDL particles bind to the extracellular domain of the protein, they are internalized into the cell through a process called receptor-mediated endocytosis. This allows the cell to take up the cholesterol from the LDL particles and regulate its levels.

In addition to its role in cholesterol regulation, Recombinant Human LDLR Protein also plays a crucial role in other cellular processes such as cell signaling, cell growth, and cell migration. It has been shown to interact with various proteins involved in these processes, indicating its diverse functions in the body.

The Application of Recombinant Human LDLR Protein

Recombinant Human LDLR Protein has numerous applications in the field of medicine and research. One of its primary applications is in the treatment of familial hypercholesterolemia (FH), a genetic disorder characterized by high levels of LDL cholesterol in the blood. Mutations in the gene encoding Recombinant Human LDLR Protein are the most common cause of FH, and recombinant protein therapy has been shown to effectively lower cholesterol levels in patients with this disorder.

Furthermore, Recombinant Human LDLR Protein has been used in research studies to investigate its role in various diseases such as atherosclerosis, Alzheimer’s disease, and cancer. It has also been used in the development of new drugs targeting cholesterol regulation and has shown promising results in clinical trials.

In conclusion, Recombinant Human LDLR Protein is a vital protein in the regulation of cholesterol homeostasis and has diverse functions in the body. Its structure, activity, and applications make it a crucial protein in both medicine and research. With ongoing studies and advancements in technology, this protein continues to hold great potential in the treatment and understanding of various diseases.

Recombinant Human LDLR Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Human LDLR Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products