Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LGALS13, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UHV8
Molecular weight:
42.96 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Met1–Asn139
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LGALS13, N-GST

Product name ARO-P13026-100
Uniprot ID Q9UHV8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Molecular weight 42.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn139
Aliases /Synonyms Gal-13, PLAC8, Placental tissue protein 13, LGALS13, PP13, Galactoside-binding soluble lectin 13, Galectin-13, Placental protein 13
Reference ARO-P13026
Note For research use only.
Molecular Constructor
Met1–Asn139
Product name ARO-P13026-1MG
Uniprot ID Q9UHV8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Molecular weight 42.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn139
Aliases /Synonyms Gal-13, PLAC8, Placental tissue protein 13, LGALS13, PP13, Galactoside-binding soluble lectin 13, Galectin-13, Placental protein 13
Reference ARO-P13026
Note For research use only.
Molecular Constructor
Met1–Asn139
Product name ARO-P13026-50
Uniprot ID Q9UHV8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
Molecular weight 42.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn139
Aliases /Synonyms Gal-13, PLAC8, Placental tissue protein 13, LGALS13, PP13, Galactoside-binding soluble lectin 13, Galectin-13, Placental protein 13
Reference ARO-P13026
Note For research use only.
Molecular Constructor
Met1–Asn139

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various scientific applications. One such recombinant protein is human LGALS13, which has gained significant attention due to its diverse biological activities and potential therapeutic applications. In this article, we will discuss the structure, activity, and application of recombinant human LGALS13.

Structure of Recombinant Human LGALS13

LGALS13, also known as Galectin-13, is a member of the galectin family of proteins. It is a 135 amino acid protein with a molecular weight of approximately 15 kDa. The recombinant human LGALS13 is produced by cloning and expressing the LGALS13 gene in a suitable host, such as E. coli or mammalian cells.

The recombinant protein has a similar structure to its native form, consisting of a single carbohydrate recognition domain (CRD) that is responsible for its binding to specific carbohydrate structures. It also has a conserved N-terminal domain that is involved in protein-protein interactions.

Activity of Recombinant Human LGALS13

LGALS13 is a multifunctional protein with various biological activities. One of its main functions is its ability to bind to specific carbohydrate structures, such as N-acetyllactosamine and galactosyl residues. This interaction plays a crucial role in cell adhesion, migration, and signaling processes.

Moreover, recombinant human LGALS13 has been shown to have anti-inflammatory and immunomodulatory properties. It can inhibit the production of pro-inflammatory cytokines and promote the production of anti-inflammatory cytokines, thus regulating the immune response. This activity makes it a potential therapeutic agent for inflammatory diseases.

Additionally, LGALS13 has been found to have anti-tumor effects. It can induce apoptosis, inhibit cell proliferation, and suppress angiogenesis in various cancer cell lines. These properties make it a promising candidate for cancer treatment.

Application of Recombinant Human LGALS13

The diverse biological activities of recombinant human LGALS13 make it a valuable tool in many scientific applications. One of its main applications is in the field of cancer research. The anti-tumor effects of LGALS13 make it a potential target for cancer therapy, and its ability to bind to specific carbohydrate structures can be utilized in targeted drug delivery systems.

Furthermore, recombinant human LGALS13 has shown promising results in the treatment of inflammatory diseases. Its anti-inflammatory and immunomodulatory properties make it a potential therapeutic agent for conditions such as rheumatoid arthritis, inflammatory bowel disease, and multiple sclerosis.

In addition, LGALS13 has been studied for its role in pregnancy and fetal development. It has been found to play a crucial role in placental development and maintenance, making it a potential biomarker for pregnancy complications.

Conclusion

In conclusion, recombinant human LGALS13 is a versatile protein with various biological activities and potential therapeutic applications. Its structure and activity make it a valuable tool in cancer research, inflammatory diseases, and pregnancy complications. With further research and development, recombinant human LGALS13 has the potential to make a significant impact in the field of biotechnology and medicine.

Keywords: Recombinant protein, antigen, LGALS13, galectin, structure, activity, application

Recombinant Human LGALS13, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human LGALS13, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products