Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MATR3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P43243
Molecular weight:
23.83 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Lys478–Val576
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MATR3 Protein, N-His-SUMO

Product name ARO-P12119-100
Uniprot ID P43243
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLV
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys478-Val576
Aliases /Synonyms Matrin-3, KIAA0723, MATR3
Reference ARO-P12119
Note For research use only.
Molecular Constructor
Lys478–Val576
Product name ARO-P12119-1MG
Uniprot ID P43243
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLV
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys478-Val576
Aliases /Synonyms Matrin-3, KIAA0723, MATR3
Reference ARO-P12119
Note For research use only.
Molecular Constructor
Lys478–Val576
Product name ARO-P12119-50
Uniprot ID P43243
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KKPEGKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMETREDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLV
Molecular weight 23.83 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys478-Val576
Aliases /Synonyms Matrin-3, KIAA0723, MATR3
Reference ARO-P12119
Note For research use only.
Molecular Constructor
Lys478–Val576

Introduction

Recombinant Human MATR3 Protein is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein is a member of the matrin family and is involved in various cellular processes such as RNA metabolism, transcription, and DNA repair. In this article, we will discuss the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human MATR3 Protein

The MATR3 gene encodes a protein of 1261 amino acids, with a molecular weight of approximately 130 kDa. The recombinant protein is produced in a prokaryotic expression system and has a His-tag at the N-terminus for purification purposes. The purified protein is a homodimer with each monomer consisting of several functional domains.

The N-terminal domain of MATR3 contains a bipartite nuclear localization signal, which is responsible for the protein’s nuclear localization. This domain also contains two RNA recognition motifs (RRMs) that are essential for RNA binding. The central domain of MATR3 is rich in glycine and arginine residues and is involved in protein-protein interactions. The C-terminal domain contains a zinc finger motif, which is crucial for DNA binding and transcriptional regulation.

Activity of Recombinant Human MATR3 Protein

Recombinant Human MATR3 Protein is a multifunctional protein that plays a critical role in various cellular processes. One of its main functions is in RNA metabolism, where it binds to and regulates the processing, splicing, and transport of RNA molecules. MATR3 also interacts with other proteins involved in RNA metabolism, such as RNA helicases and RNA polymerases, to regulate their activity.

In addition to its role in RNA metabolism, MATR3 is also involved in transcriptional regulation. It interacts with transcription factors and co-regulators to modulate gene expression. MATR3 also plays a role in DNA repair, where it is recruited to sites of DNA damage and aids in the repair process.

Applications of Recombinant Human MATR3 Protein

Given its diverse functions, Recombinant Human MATR3 Protein has a wide range of applications in both research and therapeutic settings. One of the main applications of this protein is in studying RNA metabolism and gene expression. Researchers can use recombinant MATR3 to study the role of this protein in various cellular processes and its interactions with other proteins.

In addition, recombinant MATR3 has potential therapeutic applications. Studies have shown that mutations in the MATR3 gene are associated with several diseases, including amyotrophic lateral sclerosis (ALS) and distal myopathy. Recombinant MATR3 can be used in drug discovery and development for these diseases, as well as for other conditions where MATR3 dysregulation is implicated.

Furthermore, recombinant MATR3 can be used as an antigen in diagnostic assays for diseases associated with MATR3 mutations. Its high purity and biological activity make it an ideal candidate for developing sensitive and specific diagnostic tests.

Conclusion

Recombinant Human MATR3 Protein is a highly purified and biologically active protein that plays a critical role in various cellular processes. Its structure, activity, and applications make it an essential tool for studying RNA metabolism, gene expression, and potential therapeutic targets. As research on this protein continues, its potential for diagnostic and therapeutic applications will only increase.

Recombinant Human MATR3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MATR3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products