Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MIB1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86YT6
Molecular weight:
27.89 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Arg769–Glu1000
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MIB1, N-His

Product name ARO-P13261-100
Uniprot ID Q86YT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIE
Molecular weight 27.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg769-Glu1000
Aliases /Synonyms Zinc finger ZZ type with ankyrin repeat domain protein 2, MIB1, DIP-1, Mind bomb homolog 1, ZZANK2, DAPK-interacting protein 1, E3 ubiquitin-protein ligase MIB1, KIAA1323, DIP1, RING-type E3 ubiquitin transferase MIB1
Reference ARO-P13261
Note For research use only.
Molecular Constructor
Arg769–Glu1000
Product name ARO-P13261-1MG
Uniprot ID Q86YT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIE
Molecular weight 27.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg769-Glu1000
Aliases /Synonyms Zinc finger ZZ type with ankyrin repeat domain protein 2, MIB1, DIP-1, Mind bomb homolog 1, ZZANK2, DAPK-interacting protein 1, E3 ubiquitin-protein ligase MIB1, KIAA1323, DIP1, RING-type E3 ubiquitin transferase MIB1
Reference ARO-P13261
Note For research use only.
Molecular Constructor
Arg769–Glu1000
Product name ARO-P13261-50
Uniprot ID Q86YT6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIE
Molecular weight 27.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg769-Glu1000
Aliases /Synonyms Zinc finger ZZ type with ankyrin repeat domain protein 2, MIB1, DIP-1, Mind bomb homolog 1, ZZANK2, DAPK-interacting protein 1, E3 ubiquitin-protein ligase MIB1, KIAA1323, DIP1, RING-type E3 ubiquitin transferase MIB1
Reference ARO-P13261
Note For research use only.
Molecular Constructor
Arg769–Glu1000

Introduction

Recombinant Human MIB1 is a protein that plays a crucial role in regulating cell proliferation and differentiation. It belongs to the Mind Bomb (MIB) family of proteins, which are involved in the Notch signaling pathway. This pathway is essential for proper development and function of various tissues and organs in the body. Recombinant Human MIB1 is a highly studied protein with important implications in various biological processes and potential therapeutic applications.

Structure of Recombinant Human MIB1

Recombinant Human MIB1 is a 100 kDa protein that consists of 910 amino acids. It contains several domains, including a RING finger domain, a WWE domain, and multiple ankyrin repeats. These domains are important for the protein’s function in the Notch signaling pathway. The RING finger domain is responsible for the E3 ubiquitin ligase activity of MIB1, while the ankyrin repeats are involved in protein-protein interactions.

Activity of Recombinant Human MIB1

Recombinant Human MIB1 is primarily known for its role in the Notch signaling pathway. This pathway is involved in cell fate determination, cell proliferation, and cell differentiation. MIB1 acts as an E3 ubiquitin ligase, which targets the Notch receptor for degradation. This process is crucial for regulating the activity of the Notch signaling pathway and maintaining proper cellular homeostasis.

In addition to its role in the Notch signaling pathway, Recombinant Human MIB1 has also been shown to interact with other proteins and regulate their activity. For example, MIB1 has been found to interact with the tumor suppressor protein p53 and regulate its stability and activity. This suggests that MIB1 may have implications in cancer development and progression.

Application of Recombinant Human MIB1

The unique structure and activity of Recombinant Human MIB1 make it a valuable tool for various research and therapeutic applications. One of the most significant applications of MIB1 is in studying the Notch signaling pathway. Recombinant Human MIB1 can be used to investigate the role of MIB1 in regulating Notch receptor activity and downstream signaling events. This can provide valuable insights into the molecular mechanisms of cell proliferation and differentiation.

Furthermore, Recombinant Human MIB1 has potential therapeutic applications. As mentioned earlier, MIB1 has been found to interact with p53, which is a key player in cancer development. Therefore, MIB1 inhibitors may have the potential to be developed as anti-cancer drugs. Additionally, MIB1 has also been linked to various other diseases, such as Alzheimer’s and cardiovascular diseases, making it a promising target for drug development.

Conclusion

Recombinant Human MIB1 is a crucial protein involved in the Notch signaling pathway and various other biological processes. Its unique structure and activity make it a valuable tool for studying cellular mechanisms and potential therapeutic applications. Further research on MIB1 may lead to the development of novel treatments for various diseases, making it an exciting area of study in the field of molecular biology.

Recombinant Human MIB1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MIB1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products