Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MICOS13 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5XKP0
Molecular weight:
22.56 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Asp27–Lys118
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MICOS13 Protein, N-His-SUMO

Product name ARO-P11270-100
Uniprot ID Q5XKP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp27-Lys118
Aliases /Synonyms Protein P117, C19orf70, MICOS13, MICOS complex subunit MIC13, QIL1, MIC13
Reference ARO-P11270
Note For research use only.
Molecular Constructor
Asp27–Lys118
Product name ARO-P11270-1MG
Uniprot ID Q5XKP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp27-Lys118
Aliases /Synonyms Protein P117, C19orf70, MICOS13, MICOS complex subunit MIC13, QIL1, MIC13
Reference ARO-P11270
Note For research use only.
Molecular Constructor
Asp27–Lys118
Product name ARO-P11270-50
Uniprot ID Q5XKP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK
Molecular weight 22.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp27-Lys118
Aliases /Synonyms Protein P117, C19orf70, MICOS13, MICOS complex subunit MIC13, QIL1, MIC13
Reference ARO-P11270
Note For research use only.
Molecular Constructor
Asp27–Lys118

Introduction

Recombinant Human MICOS13 Protein is a highly specialized protein that plays a crucial role in mitochondrial structure and function. It is a member of the mitochondrial contact site and cristae organizing system (MICOS) complex, which is responsible for maintaining the structural integrity of the mitochondria and facilitating essential cellular processes such as oxidative phosphorylation and apoptosis. In this article, we will discuss the structure, activity, and application of Recombinant Human MICOS13 Protein.

Structure of Recombinant Human MICOS13 Protein

Recombinant Human MICOS13 Protein is a 13-kDa protein that is composed of 119 amino acids. It is located in the inner mitochondrial membrane and is anchored to the membrane through its N-terminal transmembrane domain. The C-terminal region of the protein is exposed to the intermembrane space, where it interacts with other proteins of the MICOS complex.

The primary structure of Recombinant Human MICOS13 Protein is highly conserved among different species, indicating its essential role in mitochondrial function. It contains several conserved domains, including a coiled-coil domain and a highly conserved C-terminal domain, which are crucial for its function in the MICOS complex.

Activity of Recombinant Human MICOS13 Protein

Recombinant Human MICOS13 Protein is a key component of the MICOS complex, which is responsible for maintaining the structural integrity of the mitochondria. It forms a bridge between the inner and outer mitochondrial membranes, facilitating the formation of cristae junctions. These junctions are essential for the proper functioning of the mitochondria, as they provide a large surface area for oxidative phosphorylation and other metabolic processes.

In addition to its structural role, Recombinant Human MICOS13 Protein also plays a crucial role in apoptosis. It interacts with other proteins in the MICOS complex to regulate the release of cytochrome c from the mitochondria, which initiates the apoptotic cascade. This highlights the importance of Recombinant Human MICOS13 Protein in maintaining the balance between cell survival and cell death.

Application of Recombinant Human MICOS13 Protein

Recombinant Human MICOS13 Protein has numerous applications in both research and therapeutic settings. Its role in maintaining mitochondrial structure and function makes it a valuable tool for studying mitochondrial dysfunction and related diseases. It can be used to investigate the role of the MICOS complex in various cellular processes and to identify potential therapeutic targets for mitochondrial disorders.

Moreover, Recombinant Human MICOS13 Protein can also be used in drug discovery and development. As it plays a crucial role in apoptosis, it can be targeted for the development of novel anti-cancer drugs. Additionally, its involvement in mitochondrial function makes it a potential target for the treatment of metabolic disorders such as diabetes and obesity.

In conclusion, Recombinant Human MICOS13 Protein is a highly specialized protein that is essential for maintaining the structural integrity of the mitochondria and regulating apoptosis. Its unique structure and diverse functions make it a valuable tool for both basic research and therapeutic applications. Further studies on this protein are necessary to fully understand its role in mitochondrial function and to explore its potential in treating various diseases.

Recombinant Human MICOS13 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MICOS13 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products