Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MSRA, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UJ68
Molecular weight:
25.55 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Ala27–Lys235
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MSRA, N-His

Product name ARO-P13020-100
Uniprot ID Q9UJ68
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala27-Lys235
Aliases /Synonyms Peptide-methionine (S)-S-oxide reductase, PMSR, Peptide Met(O) reductase, MSRA, Protein-methionine-S-oxide reductase, Mitochondrial peptide methionine sulfoxide reductase
Reference ARO-P13020
Note For research use only.
Molecular Constructor
Ala27–Lys235
Product name ARO-P13020-1MG
Uniprot ID Q9UJ68
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala27-Lys235
Aliases /Synonyms Peptide-methionine (S)-S-oxide reductase, PMSR, Peptide Met(O) reductase, MSRA, Protein-methionine-S-oxide reductase, Mitochondrial peptide methionine sulfoxide reductase
Reference ARO-P13020
Note For research use only.
Molecular Constructor
Ala27–Lys235
Product name ARO-P13020-50
Uniprot ID Q9UJ68
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Molecular weight 25.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala27-Lys235
Aliases /Synonyms Peptide-methionine (S)-S-oxide reductase, PMSR, Peptide Met(O) reductase, MSRA, Protein-methionine-S-oxide reductase, Mitochondrial peptide methionine sulfoxide reductase
Reference ARO-P13020
Note For research use only.
Molecular Constructor
Ala27–Lys235

Introduction to Recombinant Human MSRA

Recombinant Human MSRA, also known as Methionine Sulfoxide Reductase A, is a protein that plays a crucial role in maintaining cellular health by repairing oxidative damage to proteins. It is a highly conserved enzyme found in all living organisms, and its activity is essential for various biological processes.

Structure of Recombinant Human MSRA

Recombinant Human MSRA is a 22-kDa protein that belongs to the family of thioredoxin-dependent enzymes. It is composed of 204 amino acids and has a conserved active site cysteine residue that is essential for its activity. The protein structure of Recombinant Human MSRA consists of a thioredoxin-like domain, a zinc-binding domain, and a C-terminal helical domain. This unique structure allows it to efficiently reduce methionine sulfoxide residues in proteins.

Activity of Recombinant Human MSRA

The primary function of Recombinant Human MSRA is to reduce methionine sulfoxide residues in proteins back to their original form, methionine. Methionine residues are prone to oxidation, which can lead to structural changes and loss of protein function. By reducing methionine sulfoxide, Recombinant Human MSRA helps to maintain the integrity and functionality of proteins, which is crucial for various cellular processes.

In addition to its role in repairing oxidative damage, Recombinant Human MSRA also has other important functions. It has been shown to play a role in regulating the redox state of cells, protecting against oxidative stress, and modulating the activity of other enzymes. It is also involved in the regulation of cell signaling pathways and has been linked to the aging process.

Application of Recombinant Human MSRA

Recombinant Human MSRA has a wide range of applications in both research and industrial settings. Its ability to repair oxidative damage to proteins makes it a valuable tool for studying the effects of oxidative stress on cellular processes. It is also used in the production of recombinant proteins, as the presence of methionine sulfoxide can affect the stability and activity of these proteins.

In the medical field, Recombinant Human MSRA has been studied for its potential as a therapeutic agent. It has been shown to protect against oxidative damage in various disease models, including Alzheimer’s disease, Parkinson’s disease, and cardiovascular diseases. It has also been linked to cancer prevention, as oxidative stress is a major contributor to cancer development.

Conclusion

In summary, Recombinant Human MSRA is a crucial enzyme that plays a vital role in maintaining cellular health. Its unique structure and activity make it an essential tool for studying oxidative stress and protein function. Its potential therapeutic applications make it a promising candidate for the treatment and prevention of various diseases. As research on this protein continues, it is likely that its importance in cellular processes will only continue to grow.

Recombinant Human MSRA, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MSRA, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products