Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human MSX1 Protein, N-His-KSI

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P28360
Molecular weight:
47.12 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
His-KSI Ala2–Thr303
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Human MSX1 Protein, N-His-KSI

Recombinant Human MSX1 Protein, N-His-KSI

Product name ARO-P16149-100
Uniprot ID P28360
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence APAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Molecular weight 47.12 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Thr303
Aliases /Synonyms Homeobox protein MSX-1, Homeobox protein Hox-7, Msh homeobox 1-like protein, MSX1, HOX7
Reference ARO-P16149
Note For research use only.
Molecular Constructor
His-KSI Ala2–Thr303
Product name ARO-P16149-1MG
Uniprot ID P28360
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence APAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Molecular weight 47.12 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Thr303
Aliases /Synonyms Homeobox protein MSX-1, Homeobox protein Hox-7, Msh homeobox 1-like protein, MSX1, HOX7
Reference ARO-P16149
Note For research use only.
Molecular Constructor
His-KSI Ala2–Thr303
Product name ARO-P16149-50
Uniprot ID P28360
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence APAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Molecular weight 47.12 kDa
Protein delivered with Tag? N-Terminal His-KSI Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Thr303
Aliases /Synonyms Homeobox protein MSX-1, Homeobox protein Hox-7, Msh homeobox 1-like protein, MSX1, HOX7
Reference ARO-P16149
Note For research use only.
Molecular Constructor
His-KSI Ala2–Thr303

SDS-PAGE for Recombinant Human MSX1 Protein, N-His-KSI

SDS-PAGE for Recombinant Human MSX1 Protein, N-His-KSI

Recombinant Human MSX1 Protein, N-His-KSI, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Human MSX1 Protein, N-His-KSI”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products