Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NFKBID, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NI38
Molecular weight:
28.18 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Asp46–Val285
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NFKBID, N-His

Product name ARO-P13230-100
Uniprot ID Q8NI38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPV
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp46-Val285
Aliases /Synonyms NFKB inhibitor delta, IkB-delta, TA-NFKBH, NF-kappa-B inhibitor delta, IkappaBNS, I-kappa-B-delta, T-cell activation NFKB-like protein, IKBNS, IkappaBdelta, NFKBID
Reference ARO-P13230
Note For research use only.
Molecular Constructor
Asp46–Val285
Product name ARO-P13230-1MG
Uniprot ID Q8NI38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPV
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp46-Val285
Aliases /Synonyms NFKB inhibitor delta, IkB-delta, TA-NFKBH, NF-kappa-B inhibitor delta, IkappaBNS, I-kappa-B-delta, T-cell activation NFKB-like protein, IKBNS, IkappaBdelta, NFKBID
Reference ARO-P13230
Note For research use only.
Molecular Constructor
Asp46–Val285
Product name ARO-P13230-50
Uniprot ID Q8NI38
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPV
Molecular weight 28.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp46-Val285
Aliases /Synonyms NFKB inhibitor delta, IkB-delta, TA-NFKBH, NF-kappa-B inhibitor delta, IkappaBNS, I-kappa-B-delta, T-cell activation NFKB-like protein, IKBNS, IkappaBdelta, NFKBID
Reference ARO-P13230
Note For research use only.
Molecular Constructor
Asp46–Val285

Title: Introduction to Recombinant Human NFKBID
Recombinant Human NFKBID: Structure and Function
Recombinant Human NFKBID: Role in Immune Response
Recombinant Human NFKBID: Potential Therapeutic Applications

Introduction:
Recombinant proteins have become an essential tool in the field of biotechnology, providing researchers with a means to study and manipulate various biological processes. One such recombinant protein is Recombinant Human NFKBID, a member of the nuclear factor-kappa B (NF-κB) family of transcription factors. In this article, we will explore the structure, activity, and potential applications of Recombinant Human NFKBID.

Recombinant Human NFKBID: Structure and Function:
NFKBID, also known as IκBNS, is a 47 kDa protein that is encoded by the NFKBID gene located on chromosome 19. It consists of 430 amino acids and contains several structural domains, including an N-terminal Rel homology domain (RHD) and a C-terminal ankyrin repeat domain (ARD). The RHD is responsible for DNA binding, while the ARD mediates protein-protein interactions with other NF-κB family members.

In its inactive state, NFKBID binds to the NF-κB subunit p65, preventing its translocation into the nucleus. However, upon activation by various stimuli such as cytokines, pathogens, or stress, NFKBID is phosphorylated and degraded, allowing p65 to enter the nucleus and activate the transcription of target genes involved in immune and inflammatory responses.

Recombinant Human NFKBID: Role in Immune Response:
NF-κB signaling plays a crucial role in the regulation of immune and inflammatory responses. NFKBID, as a member of this family, has been shown to modulate the activity of other NF-κB subunits, such as p65 and p50, and regulate the expression of pro-inflammatory cytokines, chemokines, and adhesion molecules.

Studies have also demonstrated that NFKBID is involved in the differentiation and function of various immune cells, including B cells, T cells, and dendritic cells. It has been shown to promote T cell survival and regulate B cell proliferation and antibody production. Additionally, NFKBID has been implicated in the regulation of immune tolerance and autoimmune diseases.

Recombinant Human NFKBID: Potential Therapeutic Applications:
Given its crucial role in immune regulation, NFKBID has emerged as a potential therapeutic target for various inflammatory and autoimmune diseases. Recombinant Human NFKBID has been used in pre-clinical studies to investigate its therapeutic potential in conditions such as rheumatoid arthritis, multiple sclerosis, and inflammatory bowel disease.

Moreover, recombinant NFKBID has also been utilized in the development of novel immunotherapies. For instance, a recent study demonstrated that NFKBID can enhance the anti-tumor activity of chimeric antigen receptor (CAR) T cells by promoting their expansion and persistence.

Conclusion:
In summary, Recombinant Human NFKBID is a key player in the regulation of immune and inflammatory responses. Its structure and function make it an attractive target for the development of therapeutics for various diseases. With ongoing research, the potential applications of recombinant NFKBID are likely to expand, providing further insights into its role in health and disease.

Recombinant Human NFKBID, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NFKBID, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products