Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NFKBIZ Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BYH8
Molecular weight:
16.89 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Gln454–Leu586
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NFKBIZ Protein, N-His

Product name ARO-P11694-100
Uniprot ID Q9BYH8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELL
Molecular weight 16.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln454-Leu586
Aliases /Synonyms NF-kappa-B inhibitor zeta, MAIL, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAP, NFKBIZ, I-kappa-B-zeta, IKBZ, Molecule possessing ankyrin repeats induced by lipopolysaccharide, IkappaBzeta
Reference ARO-P11694
Note For research use only.
Molecular Constructor
Gln454–Leu586
Product name ARO-P11694-1MG
Uniprot ID Q9BYH8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELL
Molecular weight 16.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln454-Leu586
Aliases /Synonyms NF-kappa-B inhibitor zeta, MAIL, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAP, NFKBIZ, I-kappa-B-zeta, IKBZ, Molecule possessing ankyrin repeats induced by lipopolysaccharide, IkappaBzeta
Reference ARO-P11694
Note For research use only.
Molecular Constructor
Gln454–Leu586
Product name ARO-P11694-50
Uniprot ID Q9BYH8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELL
Molecular weight 16.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln454-Leu586
Aliases /Synonyms NF-kappa-B inhibitor zeta, MAIL, IkB-zeta, IL-1 inducible nuclear ankyrin-repeat protein, INAP, NFKBIZ, I-kappa-B-zeta, IKBZ, Molecule possessing ankyrin repeats induced by lipopolysaccharide, IkappaBzeta
Reference ARO-P11694
Note For research use only.
Molecular Constructor
Gln454–Leu586

The Structure and Function of Recombinant Human NFKBIZ Protein

Recombinant Human NFKBIZ Protein, also known as Nuclear Factor of kappa light polypeptide gene enhancer in B-cells inhibitor-zeta, is a protein that plays a crucial role in the regulation of immune response and inflammation. This protein is encoded by the NFKBIZ gene and is a member of the nuclear factor-kappa B (NF-κB) family of transcription factors. In this article, we will discuss the structure, activity, and applications of Recombinant Human NFKBIZ Protein.

Structure of Recombinant Human NFKBIZ Protein

Recombinant Human NFKBIZ Protein is a 50 kDa protein consisting of 451 amino acids. It contains an N-terminal Rel homology domain (RHD) and a C-terminal ankyrin repeat domain (ARD). The RHD is responsible for DNA binding and dimerization, while the ARD mediates protein-protein interactions. The N-terminal region also contains a nuclear localization signal (NLS) that allows the protein to translocate into the nucleus.

Recombinant Human NFKBIZ Protein is highly conserved among different species, with 95% amino acid sequence identity between humans and mice. This suggests that the protein has an important and conserved function in various biological processes.

Activity of Recombinant Human NFKBIZ Protein

Recombinant Human NFKBIZ Protein is a transcription factor that regulates the expression of genes involved in immune response and inflammation. It is activated by various stimuli, including cytokines, pathogens, and stress signals. Upon activation, the protein translocates into the nucleus and binds to specific DNA sequences, known as κB sites, in the promoter regions of target genes.

Recombinant Human NFKBIZ Protein can form both homo- and heterodimers with other NF-κB family members, such as p65 and p50. This allows for a diverse range of target genes to be regulated, depending on the composition of the NF-κB complex. The activity of Recombinant Human NFKBIZ Protein is tightly regulated by various post-translational modifications, including phosphorylation, acetylation, and ubiquitination.

Applications of Recombinant Human NFKBIZ Protein

Recombinant Human NFKBIZ Protein has been extensively studied for its role in immune response and inflammation. It has been shown to play a critical role in the development and function of immune cells, such as B cells, T cells, and dendritic cells. It also regulates the production of pro-inflammatory cytokines, such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α).

Due to its involvement in immune response and inflammation, Recombinant Human NFKBIZ Protein has potential applications in the treatment of various diseases. For example, it has been shown to be dysregulated in autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. Targeting this protein could potentially modulate the immune response and provide therapeutic benefits.

Furthermore, Recombinant Human NFKBIZ Protein has also been implicated in cancer development and progression. It has been shown to promote cell proliferation and survival in various cancer types, such as breast cancer and colon cancer. Inhibiting the activity of this protein could potentially be a strategy for cancer therapy.

Conclusion

In summary, Recombinant Human NFKBIZ Protein is a 50 kDa protein that plays a crucial role in immune response and inflammation. It is composed of an N-terminal RHD and a C-terminal ARD, and its activity is tightly regulated by post-translational modifications. This protein has potential applications in the treatment of autoimmune diseases and cancer. Further research on Recombinant Human NFK

Recombinant Human NFKBIZ Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NFKBIZ Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products