Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PDE4D Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q08499
Molecular weight:
39.26 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Glu391–Thr711
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PDE4D Protein, N-His

Product name ARO-P12387-100
Uniprot ID Q08499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQST
Molecular weight 39.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu391-Thr711
Aliases /Synonyms cAMP-specific 3',5'-cyclic phosphodiesterase 4D, PDE43, PDE4D, DPDE3
Reference ARO-P12387
Note For research use only.
Molecular Constructor
Glu391–Thr711
Product name ARO-P12387-1MG
Uniprot ID Q08499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQST
Molecular weight 39.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu391-Thr711
Aliases /Synonyms cAMP-specific 3',5'-cyclic phosphodiesterase 4D, PDE43, PDE4D, DPDE3
Reference ARO-P12387
Note For research use only.
Molecular Constructor
Glu391–Thr711
Product name ARO-P12387-50
Uniprot ID Q08499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQST
Molecular weight 39.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu391-Thr711
Aliases /Synonyms cAMP-specific 3',5'-cyclic phosphodiesterase 4D, PDE43, PDE4D, DPDE3
Reference ARO-P12387
Note For research use only.
Molecular Constructor
Glu391–Thr711

Introduction

Recombinant Human PDE4D Protein, also known as Phosphodiesterase 4D, is a type of enzyme that plays a crucial role in regulating cellular signaling pathways. This protein is produced through genetic engineering techniques, making it a valuable tool in various scientific and medical applications.

Structure of Recombinant Human PDE4D Protein

The Recombinant Human PDE4D Protein is a large enzyme consisting of 809 amino acids. It belongs to the phosphodiesterase superfamily and is composed of a catalytic domain and regulatory domains. The catalytic domain is responsible for the enzymatic activity of the protein, while the regulatory domains help in the regulation of its activity.

The crystal structure of Recombinant Human PDE4D Protein has been extensively studied, revealing important insights into its function. The catalytic domain contains a conserved active site, which is essential for the hydrolysis of cyclic adenosine monophosphate (cAMP). The regulatory domains, on the other hand, have binding sites for various molecules that can modulate the enzyme’s activity.

Activity of Recombinant Human PDE4D Protein

The main function of Recombinant Human PDE4D Protein is to hydrolyze cAMP, a key signaling molecule involved in many cellular processes. This hydrolysis leads to the inactivation of cAMP, thereby regulating its levels and downstream signaling pathways.

Studies have shown that Recombinant Human PDE4D Protein is highly specific for cAMP and has a high affinity for this molecule. It is also known to be a highly efficient enzyme, with a turnover rate of up to 10,000 molecules of cAMP per minute. This makes it a crucial regulator of cAMP signaling in various physiological and pathological conditions.

Applications of Recombinant Human PDE4D Protein

Recombinant Human PDE4D Protein has a wide range of applications in both basic research and clinical settings. Some of the major applications include:

  • Drug Development: The specific and potent activity of Recombinant Human PDE4D Protein makes it an attractive target for drug development. Inhibitors of this enzyme have been developed and are currently being investigated for their potential in treating various diseases, including inflammation, autoimmune disorders, and cancer.
  • Biomarker for Disease: Studies have shown that the expression of PDE4D is altered in various diseases, making it a potential biomarker for diagnosis and prognosis. Recombinant Human PDE4D Protein can be used to detect and measure the levels of this enzyme in biological samples, providing valuable insights into disease progression and treatment response.
  • Research Tool: Recombinant Human PDE4D Protein is widely used as a research tool to study cAMP signaling and its role in different cellular processes. Its high specificity and activity make it a valuable tool for understanding the complex signaling pathways involved in various diseases.

Conclusion

In summary, Recombinant Human PDE4D Protein is a crucial enzyme with a well-defined structure and highly specific activity. It plays a vital role in regulating cAMP signaling and has numerous applications in drug development, disease diagnosis, and basic research. Its production through genetic engineering techniques has made it a valuable tool in the scientific community, providing a deeper understanding of cellular processes and potential therapeutic targets for various diseases.

Recombinant Human PDE4D Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PDE4D Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products