Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PHPT1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRX4
Molecular weight:
16.14 kDa

Original price was: $387.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
Met1–Tyr125
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PHPT1, N-His

Product name ARO-P13063-100
Uniprot ID Q9NRX4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Molecular weight 16.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr125
Aliases /Synonyms Protein histidine phosphatase, Protein janus-A homolog, PHPT1, PHP14, 14 kDa phosphohistidine phosphatase, PHP, Phosphohistidine phosphatase 1
Reference ARO-P13063
Note For research use only.
Molecular Constructor
Met1–Tyr125
Product name ARO-P13063-1MG
Uniprot ID Q9NRX4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Molecular weight 16.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr125
Aliases /Synonyms Protein histidine phosphatase, Protein janus-A homolog, PHPT1, PHP14, 14 kDa phosphohistidine phosphatase, PHP, Phosphohistidine phosphatase 1
Reference ARO-P13063
Note For research use only.
Molecular Constructor
Met1–Tyr125
Product name ARO-P13063-50
Uniprot ID Q9NRX4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Molecular weight 16.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Tyr125
Aliases /Synonyms Protein histidine phosphatase, Protein janus-A homolog, PHPT1, PHP14, 14 kDa phosphohistidine phosphatase, PHP, Phosphohistidine phosphatase 1
Reference ARO-P13063
Note For research use only.
Molecular Constructor
Met1–Tyr125

Introduction

Recombinant Human PHPT1 (prostatic acid phosphatase) is a protein that plays a crucial role in regulating the levels of phosphate in the body. It is produced through genetic engineering techniques, making it a recombinant protein. In this article, we will explore the structure, activity, and application of this important protein.

Structure of Recombinant Human PHPT1

Recombinant Human PHPT1 is a single-chain glycoprotein with a molecular weight of approximately 48 kDa. It is composed of 354 amino acids and contains two N-glycosylation sites. The protein has a conserved catalytic domain that is essential for its enzymatic activity. This domain is made up of four conserved amino acids, including two cysteine residues that form a disulfide bond, and two histidine residues that are involved in the catalytic mechanism.

Activity of Recombinant Human PHPT1

Recombinant Human PHPT1 is a member of the phosphotyrosine phosphatase (PTP) superfamily and is primarily expressed in the prostate gland. It functions as an enzyme that catalyzes the dephosphorylation of phosphotyrosine residues in proteins, leading to the regulation of cellular signaling pathways. Specifically, PHPT1 is involved in the regulation of phosphate homeostasis by dephosphorylating phosphopeptides and phosphoproteins, thus controlling the levels of phosphate in the body.

Applications of Recombinant Human PHPT1

Recombinant Human PHPT1 has a wide range of applications in both research and clinical settings. Some of these include:

1. Biomarker for Prostate Cancer

PHPT1 is normally expressed at high levels in the prostate gland, but its expression is significantly increased in prostate cancer. This makes it a potential biomarker for the early detection and monitoring of prostate cancer.

2. Diagnostic Tool for Bone Disorders

As a regulator of phosphate levels, PHPT1 has been implicated in various bone disorders, including osteoporosis and osteomalacia. Measuring the levels of PHPT1 in blood or urine samples can aid in the diagnosis and monitoring of these conditions.

3. Therapeutic Target for Metabolic Disorders

Abnormal phosphate levels have been linked to metabolic disorders such as diabetes and obesity. As PHPT1 plays a crucial role in regulating phosphate levels, it has been identified as a potential therapeutic target for these conditions.

4. Recombinant Protein Production

Recombinant Human PHPT1 can be produced in large quantities using genetic engineering techniques. This makes it a valuable tool for the production of other recombinant proteins, as it can be used as a fusion partner to enhance protein stability and solubility.

5. Vaccine Development

PHPT1 has been identified as a potential antigen for vaccine development against prostate cancer. Recombinant Human PHPT1 can be used to induce an immune response against the protein, thus providing protection against prostate cancer.

Conclusion

In summary, Recombinant Human PHPT1 is a crucial protein involved in the regulation of phosphate levels in the body. Its structure and enzymatic activity make it a valuable tool for various applications in research and clinical settings. With further research and development, this protein has the potential to contribute to the diagnosis and treatment of various diseases, making it an important target for future studies.

Recombinant Human PHPT1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PHPT1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products