Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PLEKHO1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q53GL0
Molecular weight:
16.40 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Glu23–Thr143
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PLEKHO1 Protein, N-His

Product name ARO-P11943-100
Uniprot ID Q53GL0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVT
Molecular weight 16.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Thr143
Aliases /Synonyms PH domain-containing family O member 1, CK2-interacting protein 1, Osteoclast maturation-associated gene 120 protein, OC120, JBP, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CKIP1, PLEKHO1, CKIP-1, Pleckstrin homology domain-containing family O member 1
Reference ARO-P11943
Note For research use only.
Molecular Constructor
Glu23–Thr143
Product name ARO-P11943-1MG
Uniprot ID Q53GL0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVT
Molecular weight 16.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Thr143
Aliases /Synonyms PH domain-containing family O member 1, CK2-interacting protein 1, Osteoclast maturation-associated gene 120 protein, OC120, JBP, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CKIP1, PLEKHO1, CKIP-1, Pleckstrin homology domain-containing family O member 1
Reference ARO-P11943
Note For research use only.
Molecular Constructor
Glu23–Thr143
Product name ARO-P11943-50
Uniprot ID Q53GL0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVT
Molecular weight 16.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Thr143
Aliases /Synonyms PH domain-containing family O member 1, CK2-interacting protein 1, Osteoclast maturation-associated gene 120 protein, OC120, JBP, Casein kinase 2-interacting protein 1, C-Jun-binding protein, CKIP1, PLEKHO1, CKIP-1, Pleckstrin homology domain-containing family O member 1
Reference ARO-P11943
Note For research use only.
Molecular Constructor
Glu23–Thr143

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the gene for a specific protein is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the desired protein. These proteins have become essential tools in various fields of research and medicine due to their high purity, specificity, and functionality. One such recombinant protein is the Recombinant Human PLEKHO1 Protein.

Structure of Recombinant Human PLEKHO1 Protein

PLEKHO1 (Pleckstrin homology domain-containing, family O member 1) is a protein that plays a crucial role in the regulation of cell adhesion and migration. The human PLEKHO1 gene is located on chromosome 1 and encodes a protein of 300 amino acids. The recombinant form of PLEKHO1 is produced by inserting the gene into a suitable expression vector and expressing it in a host organism. The resulting protein has a molecular weight of approximately 34 kDa and contains the pleckstrin homology (PH) domain, which is responsible for binding to phospholipids and regulating cellular signaling pathways.

Activity of Recombinant Human PLEKHO1 Protein

The main function of PLEKHO1 is to regulate cell migration and adhesion by interacting with other proteins and lipids. The PH domain of PLEKHO1 binds to phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3), which are important signaling molecules involved in cell migration. This binding leads to the activation of downstream signaling pathways, such as the PI3K/Akt pathway, which promotes cell migration and invasion. PLEKHO1 also interacts with other proteins, such as integrins and focal adhesion kinase (FAK), to regulate cell adhesion and migration.

Applications of Recombinant Human PLEKHO1 Protein

Recombinant Human PLEKHO1 Protein has various applications in both research and medicine. It is commonly used in cell migration and adhesion studies, where its interaction with PIP2 and PIP3 can be studied to understand the underlying mechanisms of cell migration. PLEKHO1 is also being investigated as a potential therapeutic target for diseases involving abnormal cell migration, such as cancer and cardiovascular diseases. In addition, recombinant PLEKHO1 can be used as an antigen in the production of antibodies for research and diagnostic purposes.

Conclusion

Recombinant Human PLEKHO1 Protein is a valuable tool in scientific research and medicine. Its structure, activity, and applications make it a crucial protein in the study of cell migration and adhesion. With further research, PLEKHO1 may also prove to be a promising therapeutic target for diseases involving abnormal cell migration. The production and use of recombinant proteins, such as PLEKHO1, have greatly advanced our understanding of biological processes and have the potential to contribute to the development of new treatments for various diseases.

Recombinant Human PLEKHO1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PLEKHO1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products