Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PTPRO Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q16827
Molecular weight:
36.67 kDa

Original price was: $415.00.Current price is: $327.00.

100ug 21% OFF + 327 loyalty points
Asn916–Val1208
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PTPRO Protein, N-His

Product name ARO-P11662-100
Uniprot ID Q16827
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDV
Molecular weight 36.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn916-Val1208
Aliases /Synonyms PTPRO, PTP-U2, PTPase U2, Glomerular epithelial protein 1, Receptor-type tyrosine-protein phosphatase O, R-PTP-O, PTPU2, GLEPP1, Protein tyrosine phosphatase U2
Reference ARO-P11662
Note For research use only.
Molecular Constructor
Asn916–Val1208
Product name ARO-P11662-1MG
Uniprot ID Q16827
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDV
Molecular weight 36.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn916-Val1208
Aliases /Synonyms PTPRO, PTP-U2, PTPase U2, Glomerular epithelial protein 1, Receptor-type tyrosine-protein phosphatase O, R-PTP-O, PTPU2, GLEPP1, Protein tyrosine phosphatase U2
Reference ARO-P11662
Note For research use only.
Molecular Constructor
Asn916–Val1208
Product name ARO-P11662-50
Uniprot ID Q16827
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDV
Molecular weight 36.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn916-Val1208
Aliases /Synonyms PTPRO, PTP-U2, PTPase U2, Glomerular epithelial protein 1, Receptor-type tyrosine-protein phosphatase O, R-PTP-O, PTPU2, GLEPP1, Protein tyrosine phosphatase U2
Reference ARO-P11662
Note For research use only.
Molecular Constructor
Asn916–Val1208

Introduction

Recombinant Human PTPRO Protein, also known as protein tyrosine phosphatase receptor type O, is a transmembrane protein that plays a crucial role in regulating cell growth and differentiation. This protein is encoded by the PTPRO gene and is expressed in various tissues including brain, kidney, and liver. Recombinant Human PTPRO Protein has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human PTPRO Protein

Recombinant Human PTPRO Protein is a type I transmembrane protein with a molecular weight of approximately 120 kDa. It consists of an extracellular domain, a transmembrane domain, and a cytoplasmic domain. The extracellular domain contains two immunoglobulin-like domains, while the cytoplasmic domain contains two phosphatase domains, D1 and D2. These domains are highly conserved and are responsible for the catalytic activity of the protein.

Activity of Recombinant Human PTPRO Protein

The main function of Recombinant Human PTPRO Protein is to regulate the activity of various signaling pathways by dephosphorylating tyrosine residues on target proteins. This activity is essential for maintaining proper cell growth, differentiation, and survival. Recombinant Human PTPRO Protein has been shown to dephosphorylate several key signaling molecules, including epidermal growth factor receptor (EGFR), platelet-derived growth factor receptor (PDGFR), and insulin receptor (IR), thereby modulating their downstream signaling pathways.

Studies have also shown that Recombinant Human PTPRO Protein plays a role in regulating cell adhesion and migration. It has been shown to interact with several adhesion molecules, such as integrins and cadherins, and regulate their activity through dephosphorylation. This activity is crucial for maintaining proper cell-cell and cell-matrix interactions, which are essential for normal tissue development and function.

Application of Recombinant Human PTPRO Protein

Due to its important role in regulating cell growth and differentiation, Recombinant Human PTPRO Protein has potential applications in various fields, including cancer research and regenerative medicine. Studies have shown that the expression of PTPRO is altered in several types of cancer, and its downregulation is associated with tumor progression and metastasis. Therefore, Recombinant Human PTPRO Protein could be used as a potential therapeutic target for cancer treatment.

In addition, Recombinant Human PTPRO Protein has been shown to promote the differentiation of stem cells into specific cell types, such as neurons and muscle cells. This property makes it a promising candidate for use in regenerative medicine, where the differentiation of stem cells is crucial for tissue repair and regeneration.

Conclusion

In summary, Recombinant Human PTPRO Protein is a transmembrane protein with important functions in regulating cell growth, differentiation, and adhesion. Its structure, activity, and potential applications have been extensively studied, and it shows promising potential in various fields, including cancer research and regenerative medicine. Further research on this protein could lead to the development of novel therapies for various diseases and disorders.

Recombinant Human PTPRO Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PTPRO Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products