Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB39B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96DA2
Molecular weight:
24.39 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met1–Gly192
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB39B Protein, N-His

Product name ARO-P12271-100
Uniprot ID Q96DA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSG
Molecular weight 24.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly192
Aliases /Synonyms RAB39B, Ras-related protein Rab-39B
Reference ARO-P12271
Note For research use only.
Molecular Constructor
Met1–Gly192
Product name ARO-P12271-1MG
Uniprot ID Q96DA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSG
Molecular weight 24.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly192
Aliases /Synonyms RAB39B, Ras-related protein Rab-39B
Reference ARO-P12271
Note For research use only.
Molecular Constructor
Met1–Gly192
Product name ARO-P12271-50
Uniprot ID Q96DA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSG
Molecular weight 24.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly192
Aliases /Synonyms RAB39B, Ras-related protein Rab-39B
Reference ARO-P12271
Note For research use only.
Molecular Constructor
Met1–Gly192

Introduction

Recombinant Human RAB39B Protein, also known as Ras-related protein Rab-39B, is a member of the small GTPase superfamily. It plays a crucial role in the regulation of intracellular vesicular trafficking and protein transport. This protein is encoded by the RAB39B gene located on chromosome X and is highly expressed in the brain, particularly in the cerebellum and hippocampus. In this article, we will discuss the structure, activity, and application of Recombinant Human RAB39B Protein.

Structure of Recombinant Human RAB39B Protein

Recombinant Human RAB39B Protein is a 22-kDa protein consisting of 200 amino acids. It belongs to the Ras superfamily of small GTPases and shares structural similarities with other members of the Rab family. The protein has a globular structure with a central core domain surrounded by five α-helices and six β-strands. It also has a flexible C-terminal extension that plays a role in its membrane association and subcellular localization.

Activity of Recombinant Human RAB39B Protein

Recombinant Human RAB39B Protein is a key regulator of intracellular vesicle trafficking. It functions as a molecular switch, cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAB39B interacts with other proteins and mediates the transport of cargo vesicles along the cytoskeleton to their specific destinations. This process is essential for maintaining the proper function of organelles and for the secretion of proteins from cells.

RAB39B also plays a role in the formation of the Golgi complex, which is responsible for sorting and modifying proteins for transport to their final destinations. It interacts with other Rab proteins and effector proteins to regulate the fusion of vesicles with the Golgi membrane. Additionally, RAB39B has been shown to be involved in the regulation of autophagy, a cellular process that degrades and recycles damaged or unnecessary components.

Application of Recombinant Human RAB39B Protein

Recombinant Human RAB39B Protein has a wide range of applications in both research and clinical settings. One of its main applications is in the study of neurological disorders, as RAB39B mutations have been linked to X-linked intellectual disability and Parkinson’s disease. Recombinant RAB39B protein can be used to investigate the role of this protein in the development and progression of these disorders.

Furthermore, RAB39B has been identified as a potential therapeutic target for cancer treatment. Its overexpression has been observed in several types of cancer, including breast, lung, and colorectal cancer. Inhibiting RAB39B activity could potentially disrupt the transport of proteins and limit the growth and spread of cancer cells.

Recombinant Human RAB39B Protein has also been used in drug discovery and development. By studying the interactions of RAB39B with other proteins and small molecules, researchers can identify potential drug targets and develop new therapies for various diseases.

Conclusion

In summary, Recombinant Human RAB39B Protein is a small GTPase that plays a critical role in intracellular vesicular trafficking and protein transport. Its structure and activity make it a key regulator of organelle function and cellular processes such as autophagy. Its applications in research and medicine make it a valuable tool for understanding and treating various diseases. Further studies on this protein will undoubtedly uncover more of its functions and potential therapeutic uses.

Recombinant Human RAB39B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB39B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products