Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RGS17 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UGC6
Molecular weight:
18.49 kDa

Original price was: $363.00.Current price is: $327.00.

100ug 10% OFF + 327 loyalty points
Thr74–Ser210
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RGS17 Protein, N-His

Product name ARO-P11762-100
Uniprot ID Q9UGC6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Molecular weight 18.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr74-Ser210
Aliases /Synonyms RGS17, Regulator of G-protein signaling 17, RGSZ2
Reference ARO-P11762
Note For research use only.
Molecular Constructor
Thr74–Ser210
Product name ARO-P11762-1MG
Uniprot ID Q9UGC6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Molecular weight 18.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr74-Ser210
Aliases /Synonyms RGS17, Regulator of G-protein signaling 17, RGSZ2
Reference ARO-P11762
Note For research use only.
Molecular Constructor
Thr74–Ser210
Product name ARO-P11762-50
Uniprot ID Q9UGC6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
Molecular weight 18.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr74-Ser210
Aliases /Synonyms RGS17, Regulator of G-protein signaling 17, RGSZ2
Reference ARO-P11762
Note For research use only.
Molecular Constructor
Thr74–Ser210

The Structure of Recombinant Human RGS17 Protein

Recombinant Human RGS17 Protein is a protein that plays a crucial role in regulating signaling pathways in the body. It is a member of the Regulator of G protein Signaling (RGS) family, which consists of over 30 proteins that are involved in the regulation of G protein-coupled receptor (GPCR) signaling. RGS17 is a small protein, consisting of 209 amino acids, with a molecular weight of approximately 24 kDa.

The primary structure of RGS17 includes a highly conserved RGS domain, which is responsible for its function as a GTPase-activating protein (GAP). This domain is composed of approximately 120 amino acids and is responsible for the interaction with G proteins. RGS17 also contains a cysteine-rich region, which is important for its membrane localization, and a C-terminal PDZ-binding domain, which is involved in protein-protein interactions.

In terms of secondary structure, RGS17 is composed of both alpha-helices and beta-sheets. The RGS domain contains six alpha-helices and six beta-sheets, while the cysteine-rich region has four alpha-helices and two beta-sheets. These structural elements are important for the proper functioning of RGS17.

The Activity of Recombinant Human RGS17 Protein

The main function of RGS17 is to regulate GPCR signaling by acting as a GAP for G alpha subunits. GPCRs are a large family of cell surface receptors that are involved in a variety of physiological processes, including vision, smell, taste, and hormone regulation. These receptors transmit signals by activating G proteins, which in turn activate downstream signaling pathways. RGS17 plays a critical role in this process by accelerating the hydrolysis of GTP to GDP, thereby inactivating G proteins and terminating the signaling cascade.

In addition to its role as a GAP, RGS17 has also been shown to interact with other proteins and modulate their activity. For example, RGS17 has been found to interact with the protein kinase C (PKC) signaling pathway, which is involved in cell survival and proliferation. RGS17 can also regulate the activity of the transcription factor NF-kappaB, which plays a key role in inflammation and immune response.

The Application of Recombinant Human RGS17 Protein

Recombinant Human RGS17 Protein has a wide range of applications in both research and therapeutic settings. As a key regulator of GPCR signaling, RGS17 is an important tool for studying the function of GPCRs and their associated signaling pathways. Recombinant RGS17 protein can be used to investigate the effects of RGS17 on specific GPCR-mediated signaling events, as well as its interactions with other proteins.

In addition, RGS17 has potential therapeutic applications. Dysregulation of GPCR signaling has been implicated in a variety of diseases, including cancer, cardiovascular disease, and neurological disorders. As RGS17 plays a critical role in regulating GPCR signaling, it has been identified as a potential target for drug development. Recombinant RGS17 protein can be used in drug screening assays to identify compounds that can modulate its activity and potentially treat diseases associated with GPCR dysfunction.

In conclusion, Recombinant Human RGS17 Protein is a crucial protein involved in the regulation of GPCR signaling. Its structure, activity, and potential applications make it a valuable tool for understanding the complex signaling pathways in the body and developing new treatments for various diseases.

Recombinant Human RGS17 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RGS17 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products