Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RNASE13, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q5GAN3
Molecular weight:
13.67 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Val20–His116
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RNASE13, N-His

Product name ARO-P13310-100
Uniprot ID Q5GAN3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSH
Molecular weight 13.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val20-His116
Aliases /Synonyms RNASE13, Probable inactive ribonuclease-like protein 13
Reference ARO-P13310
Note For research use only.
Molecular Constructor
Val20–His116
Product name ARO-P13310-1MG
Uniprot ID Q5GAN3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSH
Molecular weight 13.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val20-His116
Aliases /Synonyms RNASE13, Probable inactive ribonuclease-like protein 13
Reference ARO-P13310
Note For research use only.
Molecular Constructor
Val20–His116
Product name ARO-P13310-50
Uniprot ID Q5GAN3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSH
Molecular weight 13.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val20-His116
Aliases /Synonyms RNASE13, Probable inactive ribonuclease-like protein 13
Reference ARO-P13310
Note For research use only.
Molecular Constructor
Val20–His116

Introduction to Recombinant Human RNASE13

Recombinant Human RNASE13, also known as Ribonuclease 13, is a recombinant protein that has been produced through genetic engineering techniques. It is a member of the ribonuclease A superfamily and plays a crucial role in various physiological processes. In this article, we will discuss the structure, activity, and applications of Recombinant Human RNASE13 in detail.

Structure of Recombinant Human RNASE13

Recombinant Human RNASE13 is a small protein consisting of 124 amino acids with a molecular weight of 13.7 kDa. It is composed of a single polypeptide chain with four disulfide bonds that stabilize its three-dimensional structure. The protein has a unique tertiary structure with a characteristic alpha-helical fold and a beta-sheet. The active site of RNASE13 is located in a cleft formed by two loops, known as the S-peptide and S-protein, which are essential for its catalytic activity.

Activity of Recombinant Human RNASE13

Recombinant Human RNASE13 is a potent endoribonuclease, which means it can cleave RNA molecules at specific sites. It has a preference for single-stranded RNA and hydrolyzes the phosphodiester bonds between the 5′-phosphate group and the 3′-hydroxyl group of RNA. This activity is essential for various physiological processes, such as RNA turnover, RNA processing, and mRNA degradation. Additionally, RNASE13 has also been shown to have antiviral and antibacterial properties, making it a crucial component of the innate immune system.

Applications of Recombinant Human RNASE13

The unique structure and activity of Recombinant Human RNASE13 make it a valuable tool in various scientific fields. Here are some of its applications:

Recombinant Protein Production

Recombinant Human RNASE13 can be produced in large quantities through genetic engineering techniques, making it a readily available protein for research purposes. Its small size and stability make it an ideal candidate for protein expression and purification studies.

Antigen for Diagnostic Tests

RNASE13 has been identified as a potential antigen for diagnostic tests for various diseases. Antibodies against RNASE13 have been found in patients with autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. These antibodies can be used as biomarkers for disease diagnosis and monitoring.

Antimicrobial Agent

Studies have shown that Recombinant Human RNASE13 has potent antimicrobial activity against both bacteria and viruses. It has been shown to inhibit the growth of various pathogenic bacteria, including Staphylococcus aureus and Pseudomonas aeruginosa. It has also been found to have antiviral activity against HIV, influenza, and herpes simplex virus.

Therapeutic Potential

Due to its ability to cleave RNA, Recombinant Human RNASE13 has shown potential as a therapeutic agent for various diseases. It has been studied as a potential treatment for viral infections, cancer, and autoimmune diseases. Its small size and stability make it an attractive candidate for drug development.

Research Tool

Recombinant Human RNASE13 has been used as a research tool to study various biological processes, such as RNA metabolism and innate immunity. Its ability to cleave RNA at specific sites makes it a valuable tool for studying RNA structure and function.

Conclusion

In conclusion, Recombinant Human RNASE13 is a small but powerful protein with a unique structure and activity. Its role in various physiological processes and its potential applications in research and medicine make it a valuable tool in the scientific community. Further studies on this protein

Recombinant Human RNASE13, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RNASE13, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products