Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RNF2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99496
Molecular weight:
15.13 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Glu225–Lys336
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RNF2 Protein, N-His

Product name ARO-P10698-100
Uniprot ID Q99496
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Molecular weight 15.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu225-Lys336
Aliases /Synonyms Huntingtin-interacting protein 2-interacting protein 3, RING-type E3 ubiquitin transferase RING2, E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, DING, RING finger protein 1B, BAP1, Protein DinG, RING1B, RING finger protein 2, HIPI3, RNF2, RING finger protein BAP-1, RING1b
Reference ARO-P10698
Note For research use only.
Molecular Constructor
Glu225–Lys336
Product name ARO-P10698-1MG
Uniprot ID Q99496
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Molecular weight 15.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu225-Lys336
Aliases /Synonyms Huntingtin-interacting protein 2-interacting protein 3, RING-type E3 ubiquitin transferase RING2, E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, DING, RING finger protein 1B, BAP1, Protein DinG, RING1B, RING finger protein 2, HIPI3, RNF2, RING finger protein BAP-1, RING1b
Reference ARO-P10698
Note For research use only.
Molecular Constructor
Glu225–Lys336
Product name ARO-P10698-50
Uniprot ID Q99496
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Molecular weight 15.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu225-Lys336
Aliases /Synonyms Huntingtin-interacting protein 2-interacting protein 3, RING-type E3 ubiquitin transferase RING2, E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, DING, RING finger protein 1B, BAP1, Protein DinG, RING1B, RING finger protein 2, HIPI3, RNF2, RING finger protein BAP-1, RING1b
Reference ARO-P10698
Note For research use only.
Molecular Constructor
Glu225–Lys336

Introduction:

Recombinant Human RNF2 Protein, also known as Ring Finger Protein 2, is a highly conserved protein that plays a crucial role in regulating gene expression and protein degradation. It is a member of the RING finger family of proteins and is involved in various cellular processes, including cell proliferation, differentiation, and apoptosis. In this article, we will discuss the structure, activity, and applications of Recombinant Human RNF2 Protein.

Structure of Recombinant Human RNF2 Protein:

Recombinant Human RNF2 Protein is a 214 amino acid protein with a molecular weight of approximately 24 kDa. It contains a C3HC4-type RING finger domain at the N-terminus and a C-terminal domain, which is highly conserved among species. The RING finger domain is responsible for the E3 ubiquitin ligase activity of RNF2, while the C-terminal domain is involved in protein-protein interactions.

Activity of Recombinant Human RNF2 Protein:

Recombinant Human RNF2 Protein is a key regulator of the polycomb repressive complex 1 (PRC1), a multiprotein complex that is involved in gene silencing and chromatin remodeling. RNF2 acts as an E3 ubiquitin ligase and targets histone H2A at lysine 119 for monoubiquitination, leading to transcriptional repression of target genes. This activity of RNF2 is essential for maintaining the balance between cell proliferation and differentiation.

In addition to its role in PRC1, Recombinant Human RNF2 Protein has been shown to interact with other proteins, such as the tumor suppressor protein p53 and the transcription factor NF-κB. These interactions suggest a potential role for RNF2 in regulating cell cycle progression and immune response.

Applications of Recombinant Human RNF2 Protein:

1. Recombinant Human RNF2 Protein as a research tool:

Recombinant Human RNF2 Protein is widely used as a research tool to study its role in various cellular processes. It can be expressed and purified in large quantities, making it a valuable tool for in vitro and in vivo studies. Its ability to interact with other proteins also makes it a useful tool for studying protein-protein interactions.

2. Recombinant Human RNF2 Protein in drug discovery:

The dysregulation of RNF2 has been linked to various diseases, including cancer. Therefore, Recombinant Human RNF2 Protein is being studied as a potential therapeutic target for the development of drugs for cancer treatment. Its role in regulating the activity of p53, a key tumor suppressor protein, makes it an attractive target for cancer therapy.

3. Recombinant Human RNF2 Protein in antibody production:

Recombinant Human RNF2 Protein has been used as an antigen to generate antibodies for research and diagnostic purposes. Antibodies against RNF2 have been shown to have potential diagnostic and prognostic value in various cancers, including breast cancer and glioblastoma.

4. Recombinant Human RNF2 Protein in stem cell research:

RNF2 has been shown to play a crucial role in the maintenance of stem cell pluripotency. Therefore, Recombinant Human RNF2 Protein is being used in stem cell research to study its role in regulating stem cell differentiation and self-renewal.

Conclusion:

Recombinant Human RNF2 Protein is a versatile protein with a crucial role in regulating gene expression and protein degradation. Its well-defined structure and activity make it a valuable tool for research, drug discovery, and antibody production. Further studies on RNF2 and its interactions with other proteins may reveal new insights into its role in various cellular processes and its potential as a therapeutic target for various diseases.

Recombinant Human RNF2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RNF2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products