Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RXFP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9HBX9
Molecular weight:
19.67 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
His260–Arg409
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RXFP1, N-His

Product name ARO-P13096-100
Uniprot ID Q9HBX9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQR
Molecular weight 19.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His260-Arg409
Aliases /Synonyms LGR7, Relaxin family peptide receptor 1, Relaxin receptor 1, Leucine-rich repeat-containing G-protein coupled receptor 7, RXFP1
Reference ARO-P13096
Note For research use only.
Molecular Constructor
His260–Arg409
Product name ARO-P13096-1MG
Uniprot ID Q9HBX9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQR
Molecular weight 19.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His260-Arg409
Aliases /Synonyms LGR7, Relaxin family peptide receptor 1, Relaxin receptor 1, Leucine-rich repeat-containing G-protein coupled receptor 7, RXFP1
Reference ARO-P13096
Note For research use only.
Molecular Constructor
His260–Arg409
Product name ARO-P13096-50
Uniprot ID Q9HBX9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQR
Molecular weight 19.67 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His260-Arg409
Aliases /Synonyms LGR7, Relaxin family peptide receptor 1, Relaxin receptor 1, Leucine-rich repeat-containing G-protein coupled receptor 7, RXFP1
Reference ARO-P13096
Note For research use only.
Molecular Constructor
His260–Arg409

Introduction

Recombinant Human RXFP1 is a protein that plays a crucial role in various biological processes, including cell proliferation, differentiation, and survival. This protein is encoded by the RXFP1 gene and is also known as Relaxin Family Peptide Receptor 1. It belongs to the G protein-coupled receptor (GPCR) family and is widely expressed in various tissues, including the brain, heart, and reproductive organs. In this article, we will discuss the structure, activity, and application of Recombinant Human RXFP1.

Structure of Recombinant Human RXFP1

The gene encoding human RXFP1 is located on chromosome 4 and is approximately 70 kilobases in length. The protein consists of 7 transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. The extracellular N-terminus contains a leucine-rich repeat domain, which is involved in ligand binding. The intracellular C-terminus is responsible for G protein coupling and downstream signaling.

Recombinant Human RXFP1 is produced through genetic engineering techniques, where the gene encoding the protein is inserted into a suitable expression system, such as bacteria or mammalian cells. This results in the production of a purified protein that is identical to the naturally occurring human RXFP1.

Activity of Recombinant Human RXFP1

The primary function of Recombinant Human RXFP1 is to bind to its ligands, relaxin and insulin-like peptide 3 (INSL3), and activate downstream signaling pathways. These ligands are members of the relaxin peptide family and play important roles in reproductive physiology, cardiovascular function, and wound healing.

Upon ligand binding, Recombinant Human RXFP1 undergoes a conformational change, leading to the activation of G proteins and the subsequent activation of various intracellular signaling pathways, such as the cyclic adenosine monophosphate (cAMP) and mitogen-activated protein kinase (MAPK) pathways. These signaling pathways regulate a wide range of cellular processes, including cell proliferation, differentiation, and survival.

Applications of Recombinant Human RXFP1

Due to its involvement in various physiological processes, Recombinant Human RXFP1 has a wide range of potential applications in both basic research and therapeutic development.

One of the main applications of Recombinant Human RXFP1 is in reproductive biology. The relaxin ligand, which binds to RXFP1, has been shown to play a crucial role in female reproductive functions, such as ovulation, implantation, and parturition. Therefore, Recombinant Human RXFP1 can be used to study the mechanisms underlying these processes and potentially develop new treatments for reproductive disorders.

In addition, Recombinant Human RXFP1 has also been implicated in cardiovascular function. Studies have shown that RXFP1 and its ligands play a role in regulating blood pressure, heart rate, and vascular tone. Therefore, this protein could be a potential target for the development of new therapies for cardiovascular diseases.

Furthermore, Recombinant Human RXFP1 has been shown to have potential applications in wound healing. Studies have demonstrated that RXFP1 and its ligands are involved in the regulation of fibroblast proliferation and collagen synthesis, which are essential processes for wound healing. Therefore, this protein could be used in the development of new wound healing therapies.

Conclusion

In conclusion, Recombinant Human RXFP1 is a protein that plays a crucial role in various biological processes, including cell proliferation, differentiation, and survival. Its structure, activity, and potential applications make it a valuable tool for both basic research and therapeutic development. Further studies on this protein and its ligands could lead to the development of new treatments for various diseases and disorders.

Recombinant Human RXFP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RXFP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products