Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SFTPB Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P07988
Molecular weight:
38.28 kDa

Original price was: $269.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Gly290–Leu381
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SFTPB Protein, N-GST & C-His

Product name ARO-P10802-100
Uniprot ID P07988
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Molecular weight 38.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly290-Leu381
Aliases /Synonyms Pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SP-B, SFTPB, SFTP3, 6 kDa protein, 18 kDa pulmonary-surfactant protein
Reference ARO-P10802
Note For research use only.
Molecular Constructor
Gly290–Leu381
Product name ARO-P10802-1MG
Uniprot ID P07988
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Molecular weight 38.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly290-Leu381
Aliases /Synonyms Pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SP-B, SFTPB, SFTP3, 6 kDa protein, 18 kDa pulmonary-surfactant protein
Reference ARO-P10802
Note For research use only.
Molecular Constructor
Gly290–Leu381
Product name ARO-P10802-50
Uniprot ID P07988
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Molecular weight 38.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly290-Leu381
Aliases /Synonyms Pulmonary surfactant-associated protein B, Pulmonary surfactant-associated proteolipid SPL(Phe), SP-B, SFTPB, SFTP3, 6 kDa protein, 18 kDa pulmonary-surfactant protein
Reference ARO-P10802
Note For research use only.
Molecular Constructor
Gly290–Leu381

Introduction

Recombinant Human SFTPB Protein, also known as Surfactant Protein B, is a key component of the pulmonary surfactant complex that is essential for proper lung function. This protein is encoded by the SFTPB gene and is primarily produced by type II alveolar cells in the lungs. Recombinant Human SFTPB Protein has been extensively studied and has shown promising results in various applications, making it a valuable tool in the field of respiratory research.

Structure of Recombinant Human SFTPB Protein

Recombinant Human SFTPB Protein is a hydrophobic, 79-amino acid protein with a molecular weight of approximately 8.7 kDa. It is composed of three domains – a hydrophobic N-terminal domain, a hydrophilic central domain, and a hydrophobic C-terminal domain. The N-terminal domain is responsible for the protein’s interaction with phospholipids, while the central domain is involved in the protein’s dimerization. The C-terminal domain is essential for the protein’s proper folding and stability.

Activity of Recombinant Human SFTPB Protein

The primary function of Recombinant Human SFTPB Protein is to reduce surface tension at the air-liquid interface in the lungs, thereby preventing alveolar collapse during expiration. This activity is crucial for proper lung function and gas exchange. Additionally, this protein also plays a role in innate immunity, as it has been shown to have antimicrobial properties. Recombinant Human SFTPB Protein has also been found to have a protective effect against oxidative stress and inflammation in the lungs.

Application of Recombinant Human SFTPB Protein

Research

Recombinant Human SFTPB Protein has been extensively studied in various research areas, including respiratory diseases, lung development, and surfactant biology. Its role in maintaining proper lung function and its potential therapeutic applications make it a valuable tool in respiratory research. Recombinant Human SFTPB Protein has also been used in studies investigating the effects of pollution and other environmental factors on lung health.

Therapeutic Potential

Recombinant Human SFTPB Protein has shown promising results in the treatment of respiratory diseases such as acute respiratory distress syndrome (ARDS) and cystic fibrosis. Studies have shown that supplementation with this protein can improve lung function and reduce inflammation in these conditions. Additionally, Recombinant Human SFTPB Protein has been investigated as a potential therapy for lung injuries caused by radiation or chemotherapy.

Vaccine Development

Recombinant Human SFTPB Protein has also been explored as a potential antigen in vaccine development. It has been shown to induce a strong immune response and has the potential to protect against respiratory infections. This protein has been studied as a potential vaccine candidate against respiratory syncytial virus (RSV) and influenza virus.

Diagnostic Tool

The levels of Recombinant Human SFTPB Protein in the lungs and serum have been found to be altered in various respiratory diseases. This protein has been investigated as a potential biomarker for the diagnosis and monitoring of lung diseases. Its levels can also be used to assess the efficacy of therapeutic interventions.

Conclusion

Recombinant Human SFTPB Protein is a crucial component of the pulmonary surfactant complex and plays a vital role in maintaining proper lung function. Its structure, activity, and potential applications make it a valuable tool in respiratory research and therapeutics. Further studies on this protein’s properties and functions may lead to the development of new treatments for respiratory diseases and improved lung health.

Recombinant Human SFTPB Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SFTPB Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products