Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SKIV2L Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15477
Molecular weight:
21.46 kDa

Original price was: $269.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Gly803–His975
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SKIV2L Protein, N-His

Product name ARO-P12263-100
Uniprot ID Q15477
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAH
Molecular weight 21.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly803-His975
Aliases /Synonyms SKIV2L, Helicase SKI2W, W, Helicase-like protein, HLP, SKI2W, Ski2, SKIV2, DDX13
Reference ARO-P12263
Note For research use only.
Molecular Constructor
Gly803–His975
Product name ARO-P12263-1MG
Uniprot ID Q15477
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAH
Molecular weight 21.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly803-His975
Aliases /Synonyms SKIV2L, Helicase SKI2W, W, Helicase-like protein, HLP, SKI2W, Ski2, SKIV2, DDX13
Reference ARO-P12263
Note For research use only.
Molecular Constructor
Gly803–His975
Product name ARO-P12263-50
Uniprot ID Q15477
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAH
Molecular weight 21.46 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly803-His975
Aliases /Synonyms SKIV2L, Helicase SKI2W, W, Helicase-like protein, HLP, SKI2W, Ski2, SKIV2, DDX13
Reference ARO-P12263
Note For research use only.
Molecular Constructor
Gly803–His975

Introduction

Recombinant Human SKIV2L Protein, also known as Superkiller Viralicidic Activity 2-like protein, is a crucial component of the SKI complex involved in RNA degradation. This protein is encoded by the SKIV2L gene and is highly conserved among eukaryotes. Recombinant Human SKIV2L Protein is widely used in various research applications due to its essential role in RNA metabolism and its potential as a therapeutic target.

Structure of Recombinant Human SKIV2L Protein

Recombinant Human SKIV2L Protein is composed of 1,235 amino acids with a molecular weight of approximately 140 kDa. It contains multiple domains, including an N-terminal DUF111, a central RNA helicase domain, and a C-terminal DUF1795. The RNA helicase domain is responsible for the ATP-dependent unwinding of RNA molecules, while the DUF1795 domain has been shown to interact with other components of the SKI complex.

Activity of Recombinant Human SKIV2L Protein

Recombinant Human SKIV2L Protein plays a crucial role in RNA degradation through its involvement in the SKI complex. This complex is responsible for targeting and degrading aberrant or unnecessary RNA molecules, such as viral RNA, in the cell. The ATP-dependent RNA helicase activity of SKIV2L is essential for the efficient degradation of these RNA molecules. Additionally, SKIV2L has been shown to interact with other proteins involved in RNA metabolism, indicating its potential role in regulating RNA processing and stability.

Application of Recombinant Human SKIV2L Protein

1. RNA degradation studies: Recombinant Human SKIV2L Protein is widely used in studies of RNA degradation pathways. Its ATP-dependent RNA helicase activity makes it a valuable tool for investigating the mechanisms of RNA degradation and the role of the SKI complex in this process.

2. Antiviral research: As Recombinant Human SKIV2L Protein is involved in targeting and degrading viral RNA, it has potential applications in antiviral research. By understanding the role of SKIV2L in viral RNA degradation, researchers can develop targeted therapies to inhibit viral replication and infection.

3. Therapeutic target: Mutations in the SKIV2L gene have been linked to various diseases, including immunodeficiency and neurological disorders. Recombinant Human SKIV2L Protein can be used to study the effects of these mutations and potentially develop targeted therapies for these diseases.

4. Diagnostic tool: SKIV2L has been identified as a potential biomarker for various diseases, including cancer. Recombinant Human SKIV2L Protein can be used in diagnostic assays to detect the presence of SKIV2L in patient samples, aiding in disease diagnosis and monitoring.

5. Production of monoclonal antibodies: Recombinant Human SKIV2L Protein can be used as an antigen to produce monoclonal antibodies specific to SKIV2L. These antibodies can then be used in various research and diagnostic applications, such as Western blotting and immunohistochemistry.

Conclusion

Recombinant Human SKIV2L Protein is a crucial component of the SKI complex involved in RNA degradation. Its structure, activity, and potential applications make it a valuable tool for studying RNA metabolism and its role in various diseases. As research in this field continues to advance, the use of Recombinant Human SKIV2L Protein is likely to increase, contributing to a better understanding of RNA degradation and its implications in human health.

Recombinant Human SKIV2L Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SKIV2L Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products