Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC17A5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRA2
Molecular weight:
33.19 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Val65–Gln108
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC17A5 Protein, N-GST & C-His

Product name ARO-P10670-100
Uniprot ID Q9NRA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQ
Molecular weight 33.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val65-Gln108
Aliases /Synonyms H(+)/sialic acid cotransporter, H(+)/nitrate cotransporter, Sialin, AST, Vesicular H(+)/Aspartate-glutamate cotransporter, SLC17A5, Membrane glycoprotein HP59, Solute carrier family 17 member 5
Reference ARO-P10670
Note For research use only.
Molecular Constructor
Val65–Gln108
Product name ARO-P10670-1MG
Uniprot ID Q9NRA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQ
Molecular weight 33.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val65-Gln108
Aliases /Synonyms H(+)/sialic acid cotransporter, H(+)/nitrate cotransporter, Sialin, AST, Vesicular H(+)/Aspartate-glutamate cotransporter, SLC17A5, Membrane glycoprotein HP59, Solute carrier family 17 member 5
Reference ARO-P10670
Note For research use only.
Molecular Constructor
Val65–Gln108
Product name ARO-P10670-50
Uniprot ID Q9NRA2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQ
Molecular weight 33.19 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val65-Gln108
Aliases /Synonyms H(+)/sialic acid cotransporter, H(+)/nitrate cotransporter, Sialin, AST, Vesicular H(+)/Aspartate-glutamate cotransporter, SLC17A5, Membrane glycoprotein HP59, Solute carrier family 17 member 5
Reference ARO-P10670
Note For research use only.
Molecular Constructor
Val65–Gln108

Introduction

Recombinant Human SLC17A5 Protein, also known as Solute Carrier Family 17 Member 5, is a protein that is encoded by the SLC17A5 gene. This gene is located on chromosome 6 and is responsible for producing a protein that is involved in the transport of small molecules across cell membranes. The recombinant form of this protein is produced through genetic engineering techniques and has a wide range of applications in the field of biotechnology and medicine.

Structure

The recombinant form of Human SLC17A5 Protein is a 55 kDa protein that consists of 497 amino acids. It belongs to the SLC17 family of proteins, which are also known as the sodium phosphate symporters. These proteins have a characteristic structure that consists of 12 transmembrane domains and a large extracellular loop. The recombinant form of SLC17A5 Protein also contains a histidine tag at the C-terminus, which allows for easy purification and detection.

Activity

The main function of Human SLC17A5 Protein is to transport small molecules, such as organic anions, across cell membranes. This process is essential for maintaining the balance of various substances within the cell and for regulating the concentration of these substances in the surrounding environment. The recombinant form of this protein has been shown to have similar activity to the native form, making it a valuable tool for studying the function of SLC17A5 in different cellular processes.

Application

Recombinant Human SLC17A5 Protein has a wide range of applications in both research and medicine. One of the main uses of this protein is in the study of various diseases that are caused by mutations in the SLC17A5 gene. These include disorders such as Salla disease and infantile sialic acid storage disease, which are characterized by abnormal accumulation of sialic acid in the body. The recombinant form of SLC17A5 Protein can be used to study the effects of these mutations and to develop potential treatments.

Another important application of recombinant Human SLC17A5 Protein is in drug discovery and development. This protein is involved in the transport of many different substances, including drugs, across cell membranes. By studying the interaction between SLC17A5 and various drugs, researchers can gain a better understanding of how these drugs are transported into cells and how their efficacy can be improved.

In addition, recombinant Human SLC17A5 Protein can also be used in the development of diagnostic tests for diseases that are associated with mutations in the SLC17A5 gene. By detecting the levels of this protein in a patient’s blood or tissue samples, doctors can diagnose these diseases at an early stage and provide appropriate treatment.

Conclusion

Recombinant Human SLC17A5 Protein is a valuable tool for both research and medicine. Its unique structure and activity make it an important protein for studying various diseases and for drug discovery and development. With its wide range of applications, this protein has the potential to contribute to the development of new treatments and diagnostic tools for diseases associated with mutations in the SLC17A5 gene.

Recombinant Human SLC17A5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SLC17A5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products