Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC22A6 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q4U2R8
Molecular weight:
22.34 kDa

Original price was: $387.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
Thr41–Arg131
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC22A6 Protein, N-His-SUMO

Product name ARO-P12049-100
Uniprot ID Q4U2R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHR
Molecular weight 22.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr41-Arg131
Aliases /Synonyms hROAT1, PAH transporter, Solute carrier family 22 member 6, PAHT, Renal organic anion transporter 1, hPAHT, OAT1, SLC22A6, Organic anion transporter 1, hOAT1
Reference ARO-P12049
Note For research use only.
Molecular Constructor
Thr41–Arg131
Product name ARO-P12049-1MG
Uniprot ID Q4U2R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHR
Molecular weight 22.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr41-Arg131
Aliases /Synonyms hROAT1, PAH transporter, Solute carrier family 22 member 6, PAHT, Renal organic anion transporter 1, hPAHT, OAT1, SLC22A6, Organic anion transporter 1, hOAT1
Reference ARO-P12049
Note For research use only.
Molecular Constructor
Thr41–Arg131
Product name ARO-P12049-50
Uniprot ID Q4U2R8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TAAIPTHHCRPPADANLSKNGGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHR
Molecular weight 22.34 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr41-Arg131
Aliases /Synonyms hROAT1, PAH transporter, Solute carrier family 22 member 6, PAHT, Renal organic anion transporter 1, hPAHT, OAT1, SLC22A6, Organic anion transporter 1, hOAT1
Reference ARO-P12049
Note For research use only.
Molecular Constructor
Thr41–Arg131

Introduction

Recombinant Human SLC22A6 Protein, also known as solute carrier family 22 member 6, is a protein that plays a crucial role in the transport of organic cations across cell membranes. This protein is encoded by the SLC22A6 gene and is a member of the solute carrier family, which is a group of proteins that facilitate the transport of various molecules across cell membranes. Recombinant Human SLC22A6 Protein is widely used in scientific research and has various applications in the fields of pharmacology and toxicology.

Structure of Recombinant Human SLC22A6 Protein

Recombinant Human SLC22A6 Protein is a transmembrane protein that consists of 554 amino acids. It has a molecular weight of approximately 61.4 kDa and contains 12 transmembrane domains. The protein also has two large extracellular loops and two small intracellular loops. The N- and C- termini of the protein are located on the cytoplasmic side of the cell membrane.

The structure of Recombinant Human SLC22A6 Protein is highly conserved among different species, indicating its importance in cellular function. The protein has been extensively studied and its crystal structure has been determined, providing valuable insights into its function and mechanism of action.

Activity of Recombinant Human SLC22A6 Protein

Recombinant Human SLC22A6 Protein is a member of the organic cation transporter (OCT) family, which is responsible for the transport of organic cations across cell membranes. This protein specifically transports cationic drugs and endogenous compounds, such as neurotransmitters, hormones, and metabolites.

The activity of Recombinant Human SLC22A6 Protein is regulated by various factors, including pH, membrane potential, and other transporters. It functions as an antiporter, exchanging intracellular organic cations with extracellular ones. This activity is crucial for maintaining cellular homeostasis and plays a vital role in drug absorption, distribution, and elimination.

Applications of Recombinant Human SLC22A6 Protein

Recombinant Human SLC22A6 Protein has various applications in the fields of pharmacology and toxicology. Its role in drug transport and metabolism makes it a valuable tool for studying drug-drug interactions and drug toxicity. The protein is also involved in the transport of endogenous compounds, making it a potential target for drug development.

In pharmacology, Recombinant Human SLC22A6 Protein is used to study the transport and pharmacokinetics of cationic drugs. Its expression in different tissues and organs also allows for the investigation of tissue-specific drug distribution. This information is crucial for optimizing drug dosing and reducing adverse effects.

In toxicology, Recombinant Human SLC22A6 Protein is used to study the transport and elimination of toxic compounds. Its activity can be modulated by various factors, such as drug interactions and genetic polymorphisms, which can affect the toxicity of certain drugs.

Conclusion

In conclusion, Recombinant Human SLC22A6 Protein is a transmembrane protein that plays a critical role in the transport of organic cations across cell membranes. Its structure, activity, and applications have been extensively studied and provide valuable insights into its function and mechanism of action. This protein is a valuable tool for studying drug transport and metabolism and has various applications in pharmacology and toxicology. Further research on this protein may lead to the development of new drugs and therapies for various diseases.

Recombinant Human SLC22A6 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SLC22A6 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products