Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC40A1, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP59
Molecular weight:
48.59 kDa

Original price was: $303.00.Current price is: $274.00.

50ug 10% OFF + 274 loyalty points
GST Trp127–Val321
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC40A1, N-GST

Product name ARO-P13728-100
Uniprot ID Q9NP59
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence WVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTV
Molecular weight 48.59 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp127-Val321
Aliases /Synonyms Iron-regulated transporter 1, SLC40A1, FPN, FPN1, IREG1, SLC11A3, MSTP079, Solute carrier family 40 member 1, Ferroportin-1
Reference ARO-P13728
Note For research use only.
Molecular Constructor
GST Trp127–Val321
Product name ARO-P13728-1MG
Uniprot ID Q9NP59
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence WVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTV
Molecular weight 48.59 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp127-Val321
Aliases /Synonyms Iron-regulated transporter 1, SLC40A1, FPN, FPN1, IREG1, SLC11A3, MSTP079, Solute carrier family 40 member 1, Ferroportin-1
Reference ARO-P13728
Note For research use only.
Molecular Constructor
GST Trp127–Val321
Product name ARO-P13728-50
Uniprot ID Q9NP59
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence WVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTV
Molecular weight 48.59 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp127-Val321
Aliases /Synonyms Iron-regulated transporter 1, SLC40A1, FPN, FPN1, IREG1, SLC11A3, MSTP079, Solute carrier family 40 member 1, Ferroportin-1
Reference ARO-P13728
Note For research use only.
Molecular Constructor
GST Trp127–Val321

Recombinant Human SLC40A1, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human SLC40A1, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products