Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SMS Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52788
Molecular weight:
43.43 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met1–Pro366
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SMS Protein, N-His

Product name ARO-P11909-100
Uniprot ID P52788
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Molecular weight 43.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro366
Aliases /Synonyms Spermine synthase, SPMSY, SMS, Spermidine aminopropyltransferase
Reference ARO-P11909
Note For research use only.
Molecular Constructor
Met1–Pro366
Product name ARO-P11909-1MG
Uniprot ID P52788
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Molecular weight 43.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro366
Aliases /Synonyms Spermine synthase, SPMSY, SMS, Spermidine aminopropyltransferase
Reference ARO-P11909
Note For research use only.
Molecular Constructor
Met1–Pro366
Product name ARO-P11909-50
Uniprot ID P52788
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Molecular weight 43.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Pro366
Aliases /Synonyms Spermine synthase, SPMSY, SMS, Spermidine aminopropyltransferase
Reference ARO-P11909
Note For research use only.
Molecular Constructor
Met1–Pro366

Recombinant Human SMS Protein: Structure, Activity, and Application

The Structure of Recombinant Human SMS Protein

Recombinant Human SMS Protein is a protein that is produced through genetic engineering techniques, specifically through the process of recombinant DNA technology. This protein is a recombinant version of the human SMS (spermine synthase) protein, which is responsible for the production of the polyamine spermine in the body.

The recombinant version of this protein is produced in a laboratory setting using host cells, such as bacteria or yeast, that have been genetically modified to contain the gene for human SMS protein. This allows for the production of a large amount of pure and standardized recombinant protein for use in various applications.

The structure of recombinant Human SMS Protein is similar to that of the natural human protein, with a similar amino acid sequence and three-dimensional structure. This allows it to function similarly to the natural protein in the body.

The Activity of Recombinant Human SMS Protein

The main activity of recombinant Human SMS Protein is the conversion of spermidine to spermine. Spermidine and spermine are polyamines that play important roles in various cellular processes, such as cell growth, proliferation, and differentiation. The production of spermine from spermidine is essential for maintaining proper cellular function and is regulated by the activity of SMS protein.

Recombinant Human SMS Protein is highly specific and efficient in its activity, as it is produced in a controlled environment and is free from any impurities or contaminants. This allows for precise and reliable results in various applications.

In addition to its main activity, recombinant Human SMS Protein also has secondary activities, such as binding to other proteins and regulating gene expression. These activities may have potential implications in various biological processes and can be further studied for potential therapeutic applications.

The Application of Recombinant Human SMS Protein

The recombinant version of Human SMS Protein has various applications in both research and clinical settings. One of its main applications is in the study of polyamine metabolism and its role in various diseases, such as cancer, neurodegenerative disorders, and cardiovascular diseases. By understanding the activity and regulation of SMS protein, researchers can gain insight into the underlying mechanisms of these diseases and potentially develop new treatments.

Recombinant Human SMS Protein is also used in drug discovery and development, as it can serve as a target for drug screening and as a tool for studying the effects of potential therapeutic compounds on polyamine metabolism. Furthermore, this protein can be used in the production of antibodies for diagnostic and therapeutic purposes, as it is an antigen that can elicit an immune response in the body.

In clinical practice, recombinant Human SMS Protein has potential applications in the treatment of diseases related to abnormal polyamine metabolism. For example, it can be used as a therapeutic agent to regulate the levels of spermine in the body, which may be beneficial in certain diseases where abnormal polyamine levels have been observed.

Conclusion

In summary, recombinant Human SMS Protein is a genetically engineered version of the human SMS protein with a similar structure and activity. It has various applications in research and clinical settings, particularly in the study of polyamine metabolism and its role in diseases. With its high specificity and efficiency, this protein is a valuable tool for further understanding the complex processes of the human body and for developing potential treatments for various diseases.

Recombinant Human SMS Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SMS Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products