Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SORBS1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BX66
Molecular weight:
20.51 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Thr773–Pro929
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SORBS1 Protein, N-His

Product name ARO-P11225-100
Uniprot ID Q9BX66
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRP
Molecular weight 20.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr773-Pro929
Aliases /Synonyms CAP, KIAA0894, c-Cbl-associated protein, SH3 domain protein 5, Sorbin and SH3 domain-containing protein 1, SH3P12, SH3D5, KIAA1296, SORBS1, Ponsin
Reference ARO-P11225
Note For research use only.
Molecular Constructor
Thr773–Pro929
Product name ARO-P11225-1MG
Uniprot ID Q9BX66
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRP
Molecular weight 20.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr773-Pro929
Aliases /Synonyms CAP, KIAA0894, c-Cbl-associated protein, SH3 domain protein 5, Sorbin and SH3 domain-containing protein 1, SH3P12, SH3D5, KIAA1296, SORBS1, Ponsin
Reference ARO-P11225
Note For research use only.
Molecular Constructor
Thr773–Pro929
Product name ARO-P11225-50
Uniprot ID Q9BX66
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRP
Molecular weight 20.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr773-Pro929
Aliases /Synonyms CAP, KIAA0894, c-Cbl-associated protein, SH3 domain protein 5, Sorbin and SH3 domain-containing protein 1, SH3P12, SH3D5, KIAA1296, SORBS1, Ponsin
Reference ARO-P11225
Note For research use only.
Molecular Constructor
Thr773–Pro929

Introduction

Recombinant Human SORBS1 Protein, also known as Sorbin and SH3 domain-containing protein 1, is a human protein that is encoded by the SORBS1 gene. This protein belongs to the sorbin family of proteins and is involved in various cellular processes, including cell adhesion, migration, and signaling. In this article, we will discuss the structure, activity, and application of Recombinant Human SORBS1 Protein.

Structure of Recombinant Human SORBS1 Protein

Recombinant Human SORBS1 Protein is a 110 kDa protein that consists of 976 amino acids. It contains several functional domains, including a sorbin homology (SoHo) domain, a proline-rich region, and three SH3 domains. The SoHo domain is responsible for binding to actin filaments, while the SH3 domains are involved in protein-protein interactions. The proline-rich region is thought to be important for the regulation of protein-protein interactions and cellular signaling.

Activity of Recombinant Human SORBS1 Protein

Recombinant Human SORBS1 Protein is primarily involved in regulating cell adhesion and migration. It has been shown to interact with various proteins, such as integrins, focal adhesion kinase (FAK), and paxillin, which are all important for cell adhesion and migration. The SoHo domain of Recombinant Human SORBS1 Protein binds to actin filaments, which are crucial for cell movement. This interaction helps to stabilize the actin cytoskeleton and promote the formation of focal adhesions, which are necessary for cell adhesion and migration.

In addition to its role in cell adhesion and migration, Recombinant Human SORBS1 Protein is also involved in cellular signaling. It has been shown to interact with proteins involved in the mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in cell proliferation and survival. This suggests that Recombinant Human SORBS1 Protein may also play a role in regulating cell growth and survival.

Application of Recombinant Human SORBS1 Protein

Recombinant Human SORBS1 Protein has various applications in both research and clinical settings. Its role in cell adhesion and migration makes it a valuable tool for studying these processes in vitro. Recombinant Human SORBS1 Protein can be used in cell migration assays to investigate the effects of different proteins or compounds on cell movement. It can also be used to study the signaling pathways involved in cell adhesion and migration.

In addition to its research applications, Recombinant Human SORBS1 Protein has potential clinical applications. Abnormal expression of SORBS1 has been linked to various diseases, such as cancer and cardiovascular diseases. Recombinant Human SORBS1 Protein can be used to study the role of SORBS1 in these diseases and potentially develop targeted therapies. It can also be used as an antigen in diagnostic assays for diseases associated with SORBS1.

Conclusion

In summary, Recombinant Human SORBS1 Protein is a 110 kDa protein that plays an important role in cell adhesion, migration, and signaling. It contains functional domains that are involved in protein-protein interactions and actin binding. Recombinant Human SORBS1 Protein has various applications in research and clinical settings, including studying cell adhesion and migration, investigating signaling pathways, and potential therapeutic and diagnostic uses. Further research on this protein may provide valuable insights into its role in various diseases and lead to the development of targeted treatments.

Recombinant Human SORBS1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SORBS1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products