Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human UBASH3B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TF42
Molecular weight:
29.94 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Gln382–Asp626
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human UBASH3B Protein, N-His

Product name ARO-P10719-100
Uniprot ID Q8TF42
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLT
Molecular weight 29.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln382-Asp626
Aliases /Synonyms Tyrosine-protein phosphatase STS1/TULA2, TULA-2, STS1, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B, Cbl-interacting protein p70, STS-1, T-cell ubiquitin ligand 2, KIAA1959, UBASH3B
Reference ARO-P10719
Note For research use only.
Molecular Constructor
Gln382–Asp626
Product name ARO-P10719-1MG
Uniprot ID Q8TF42
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLT
Molecular weight 29.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln382-Asp626
Aliases /Synonyms Tyrosine-protein phosphatase STS1/TULA2, TULA-2, STS1, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B, Cbl-interacting protein p70, STS-1, T-cell ubiquitin ligand 2, KIAA1959, UBASH3B
Reference ARO-P10719
Note For research use only.
Molecular Constructor
Gln382–Asp626
Product name ARO-P10719-50
Uniprot ID Q8TF42
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLT
Molecular weight 29.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln382-Asp626
Aliases /Synonyms Tyrosine-protein phosphatase STS1/TULA2, TULA-2, STS1, Suppressor of T-cell receptor signaling 1, Ubiquitin-associated and SH3 domain-containing protein B, Cbl-interacting protein p70, STS-1, T-cell ubiquitin ligand 2, KIAA1959, UBASH3B
Reference ARO-P10719
Note For research use only.
Molecular Constructor
Gln382–Asp626

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various scientific applications. One such protein is the Recombinant Human UBASH3B Protein, which has gained significant interest in recent years due to its unique structure and diverse functions. In this article, we will delve into the structure, activity, and applications of this protein in detail.

Structure of Recombinant Human UBASH3B Protein

The UBASH3B protein, also known as STS-1, is a member of the ubiquitin-associated and SH3 domain-containing protein family. It is encoded by the UBASH3B gene located on chromosome 1q32.1. The protein is composed of 448 amino acids and has a molecular weight of approximately 50 kDa.

The primary structure of UBASH3B consists of an N-terminal ubiquitin-associated (UBA) domain, followed by a central SH3 domain, and a C-terminal proline-rich region. The UBA domain is responsible for binding to ubiquitin, a small regulatory protein involved in protein degradation and other cellular processes. The SH3 domain is involved in protein-protein interactions, while the proline-rich region is thought to play a role in signaling and cytoskeletal organization.

The crystal structure of UBASH3B has been determined, revealing that the protein adopts a compact globular conformation with the UBA and SH3 domains in close proximity. This structure is crucial for the protein’s activity and function.

Activity of Recombinant Human UBASH3B Protein

The UBASH3B protein is involved in various cellular processes, including immune response, cell signaling, and cytoskeletal organization. It has been shown to interact with several proteins, such as the T-cell receptor (TCR) and the Src family kinases, and regulate their activity.

One of the key functions of UBASH3B is its role in regulating T-cell activation. It has been found to negatively regulate TCR signaling by inhibiting the activity of Src family kinases, which are essential for T-cell activation. This function is crucial for maintaining immune homeostasis and preventing autoimmune diseases.

Moreover, UBASH3B has been shown to play a role in cell migration and invasion. It interacts with and regulates the activity of focal adhesion kinase (FAK), a protein involved in cell adhesion and motility. This suggests that UBASH3B may have a role in cancer metastasis and could be a potential therapeutic target for cancer treatment.

Applications of Recombinant Human UBASH3B Protein

The unique structure and diverse functions of UBASH3B make it a valuable tool in various scientific applications. One of the main applications of this protein is in the study of immune response and autoimmune diseases. Recombinant UBASH3B protein can be used to investigate the role of this protein in T-cell signaling and activation, providing insight into the mechanisms of autoimmune diseases and potential therapeutic targets.

Furthermore, the potential role of UBASH3B in cancer metastasis makes it a promising target for cancer treatment. Recombinant UBASH3B protein can be used in drug discovery and development to screen for potential inhibitors of its activity, which could be used as anti-cancer agents.

Additionally, the UBA and SH3 domains of UBASH3B have been shown to have independent functions, making them useful tools for studying protein-protein interactions and signaling pathways. Recombinant UBASH3B protein can be used in in vitro and in vivo studies to investigate these interactions and their role in various cellular processes.

Conclusion

In summary, Recombinant Human UBASH3B Protein is a unique and versatile protein with a crucial role in immune

Recombinant Human UBASH3B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human UBASH3B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products